KEGG   Accumulibacter phosphatis: CAP2UW1_3233Help
Entry
CAP2UW1_3233      CDS       T00966                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
app  Accumulibacter phosphatis
Pathway
app00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:app00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CAP2UW1_3233
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:app02000]
    CAP2UW1_3233
Enzymes [BR:app01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CAP2UW1_3233
Transporters [BR:app02000]
 Other Transporters
  Pores ion channels [TC:1]
   CAP2UW1_3233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2235 GST_N GST_C GST_N_2 GST_N_3 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ACV36503
UniProt: C7RVN0
LinkDB All DBs
Position
3718875..3721124
Genome map
AA seq 749 aa AA seqDB search
MTKQIVVCMDGTWNDPVEHTNVYRLFQMLPGEERQIEETGPIRSHLVKNSDQVIAYCFES
IGRGGRARGLLGGTQGIGLHDCMIDAYLLVSQVYQSGDKIWLFGFSRGAWAARSLGAFIA
RSGLIPAVHADDDDAADKAEKIWLDYKEGRGMKRGGRFWKHHDETPIRMIGVWETVGELG
VPLFNGLRLADRDELRFLRFADRELSPRVEHGRQALAIDEHRADFTPTPWAEREGVKQVW
FAGAHADVGGGYENHGLSDIALEWMMQEINDLDAGLQLAPDQLSEALAPDSLEDRHDETR
GPVWRTRPSKARKIPDAAELHPSVVQRLRERADYRPKALEDIPVCTDFYLDEAPRPDETL
QPEREALPFRKLPVDGSTCFPAYAHKWWNASGVEVDVGERYRIEASGAWIDKEIHAGADG
YESKAWLLHLAEGSRRMEERPWFSLVAAIHPRPDLEANNPDSENVLTGLIESTISGVARI
DDESCLLATPSGCEIEIIEPGFLYFFANDSPFSYSNNRGFLSVEVTRLPWSTDVDQKTSP
THQPVPGSLDVKLYFTPGTCSLAPHIALREAGLDFDLVRVDIRQRTLTDGSDFLAINPKG
YVPVLELEDGRYLTEVPAIVQYIADRIPECGLAPRPYTLERYQLQEWLAFISSELHKAFV
PLFRPDTPEDYKRSIKENLAGHLGYVAGRLEGRNYLLGDRFTVADGYLFTVLGWGNAVAI
DLGQWPPLLAFLERVGQRQSVRDALAAES
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcagatagtggtttgcatggatggcacctggaacgaccccgtcgagcacacc
aatgtctaccgcttgttccagatgcttcccggcgaggagcggcagatcgaggaaaccgga
cccatccgttcgcatctcgtcaagaacagcgaccaggtcatcgcttattgtttcgagagc
atcggcaggggcggacgcgcgcgcggactgctcggcggcacgcagggaatcggcctgcac
gattgcatgatcgatgcctatctgctggtttcgcaggtgtatcagagcggcgacaagatc
tggcttttcggtttctcgcgcggcgcctgggcggcgcgcagcctcggggcattcattgcc
cgctcgggcctcatcccggcggttcatgccgacgacgacgacgccgccgacaaggccgag
aagatctggctggactacaaggaagggcgcggcatgaaacgcggcggccgcttctggaag
caccacgacgaaacgccgattcgcatgatcggcgtctgggagacggtcggcgaactcggc
gtgccgctgttcaacggcctgcgtctggccgaccgggacgaactccgcttcctgcgattt
gccgaccgcgaactcagtccgcgcgtcgagcacggccgccaggccctggccatcgacgag
caccgcgccgacttcacgccgacgccgtgggccgagcgcgaaggggtcaagcaggtgtgg
ttcgccggtgcgcatgccgatgtcgggggcggctacgaaaaccacggtctctcggacatc
gccctcgaatggatgatgcaggaaatcaacgacctggatgccggcctgcagctcgcgccc
gaccaactcagcgaggcgctggcgcccgacagcctggaggaccgacacgacgaaacccga
gggccagtctggcggacgcgcccgagcaaagcacgcaagatccccgacgctgccgaactc
catcccagcgtagtgcagcgcctgcgcgagcgcgccgactatcggccgaaggcgctcgaa
gacattccggtctgcaccgacttctacctggacgaggcgccgcgcccggacgagacactg
cagccggagcgggaagccctgcccttccgcaagctgccggtggacggctcgacgtgcttc
ccggcctatgcccacaaatggtggaatgcctccggcgtcgaggtggatgtcggcgaacgc
taccgcatcgaggcgagcggcgcctggatcgacaaggagatccacgcgggtgccgacggc
tatgaatccaaggcctggctccttcacctcgccgaaggtagccgccgcatggaggaacgc
ccgtggttctcgctggtcgccgccatccatccccggcccgacctcgaggcgaacaacccc
gactccgagaatgtccttaccgggctcatcgaaagcacgatcagcggcgttgcgcgcatc
gacgacgagagctgcctgctggcgactccgagtggctgcgagatcgagattatcgaacca
ggtttcctgtacttcttcgccaacgactcgccgttttcctacagcaacaaccgcggcttc
ctttccgtcgaagtcacccgcctcccctggtcgacggatgtcgaccagaagacctcgcca
actcatcaaccggttcccggcagcctggacgtcaagctctacttcactcccggaacatgt
tcgctggcgccgcacatcgcactccgcgaagccggactcgatttcgacctcgtgcgggtc
gatatccgccagcgtacgctaaccgacggcagcgactttctcgccatcaaccccaagggc
tacgtaccggtgctggaactcgaggatggccggtatctgaccgaagtcccggccatcgtg
caatacatcgccgaccgcatcccggaatgcggtctggcaccgcgaccctacacgctcgaa
cgctaccagttgcaggagtggctcgccttcataagctccgagttgcacaaggccttcgtc
ccgctgttcaggcccgacacgccggaggattacaagcggagtatcaaggaaaaccttgcc
ggccacctgggctacgtcgccggtcgtctggaaggcaggaactacttgctgggcgaccgc
ttcaccgtcgccgacggctacctctttaccgtcctcggctggggcaacgcggtcgccatc
gaccttggccagtggccgccgctgctcgctttcctggaacgtgtcggacagcgccaaagc
gtgcgcgacgccctggcggcggaaagctga

DBGET integrated database retrieval system