KEGG   Accumulibacter phosphatis: CAP2UW1_3427Help
Entry
CAP2UW1_3427      CDS       T00966                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
app  Accumulibacter phosphatis
Pathway
app00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:app00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAP2UW1_3427
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:app01002]
    CAP2UW1_3427
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:app01011]
    CAP2UW1_3427
Enzymes [BR:app01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CAP2UW1_3427
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CAP2UW1_3427
Peptidases and inhibitors [BR:app01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   CAP2UW1_3427
Peptidoglycan biosynthesis and degradation proteins [BR:app01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CAP2UW1_3427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ACV36687
UniProt: C7RJ76
LinkDB All DBs
Position
3936908..3938233
Genome map
AA seq 441 aa AA seqDB search
MPATVSEALQEAGIPARSLGIVVQPVDGGPALLSHNARQAMNPASVMKLVTTYASLELLG
PAHTWRTEILTEAVPNNGRLDGNLYLRGSGDPKLALEQFWLLLRQLRARGLSEISGDLVL
DRSAFALAAHDPGEFDNEPLRPYNAGPDALLVNLKSVRLTLQPDPARKAVKVIAETPAEG
LRIVNRLTLGREACGDWREQIKPVISGLSIELAGSFSAACGEKALHLAPWTADVQVESLF
RALWRELGGSLGGRVREGRTPVTARPVAVQESPTLGEIVRDINKYSNNVMARQLFLSLDG
ERPATAEGARRQIAGWLQGKGLTLPELVLDNGSGLSRSERISAQGLAQLLRAAWQSPVMP
ELIASLPLAGVDGTLRKRLNDGAATGRAHLKTGYLEGVRAIAGYALDNSGRRWIVVCLIN
DPKARLAKPAIDALLLWVTKR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttgccggctaccgtcagcgaagcgctgcaggaagcaggtatcccggcgcgttcgctcggc
atcgtcgtgcagccggtcgatggcgggccggcactgctcagccacaatgccaggcaagcg
atgaacccggcctcggtaatgaagctggtcaccacctacgccagcctcgaactgctcggg
cctgcccacacctggcggaccgagatccttaccgaagccgtaccgaacaacggccgactc
gacggcaacctctatctgcgcggcagtggcgatccgaaactcgcgctcgagcagttctgg
ctgctgctgcgccagttgcgggcgcgcggactgagcgagatcagtggcgacctagtcctc
gatcgcagcgcctttgcgctggccgcgcacgatccgggcgagttcgacaacgaaccgctg
cgtccctacaatgccggccccgacgccctgctcgtcaacctcaagagcgtgcgcctcacc
ttgcagcctgacccggcgcgcaaggcagtcaaggtgatcgccgaaacgccggccgagggc
ctgcgaatcgtcaatcgcctgactctcggccgcgaagcctgcggcgactggcgcgaacag
atcaagcccgtgatcagtggcctcagcatcgagctcgccggcagtttttcggccgcctgc
ggggagaaggccttgcacctcgcgccgtggacggccgacgtgcaggtcgagagcctgttc
cgcgccctctggcgggaactcggcggcagcctcggcgggcgcgtccgtgaaggacgcacg
ccggtgaccgcgcgccccgtcgccgtccaggaatcgccgacgctcggcgagatcgtccgc
gacatcaacaagtacagcaacaacgtcatggcccgccaactgtttctgagcctcgacggc
gaacgcccggcgacggccgagggagcgcgccgccagatcgccggctggctgcagggcaag
ggactgacgctgcccgaactggtgctcgacaacggttcgggcctgtcgcgcagcgagcgc
atctcggcccaggggctggctcaactgctgcgtgccgcctggcaaagcccggtgatgccc
gaactgatcgcctcgctacccctcgccggcgtcgatggcaccttgcgcaaacggctgaac
gacggcgccgcgaccggccgcgcgcacctgaagaccggctatctcgagggcgtgcgggca
atcgccggttacgcgctcgacaacagcggcaggcgctggatcgtcgtctgcctgatcaac
gacccgaaggctcgactcgcgaaaccggccatcgatgccctgctgctctgggtgacgaag
cgctga

DBGET integrated database retrieval system