KEGG   Accumulibacter phosphatis: CAP2UW1_4458Help
Entry
CAP2UW1_4458      CDS       T00966                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
app  Accumulibacter phosphatis
Brite
KEGG Orthology (KO) [BR:app00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CAP2UW1_4458
Enzymes [BR:app01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CAP2UW1_4458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored DAO HI0933_like NAD_binding_7 FAD_binding_3 AlaDh_PNT_C Thi4 K_oxygenase FMO-like NAD_binding_8 Glutaredoxin AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ACV37686
UniProt: C7RRH5
LinkDB All DBs
Position
5040593..5042152
Genome map
AA seq 519 aa AA seqDB search
MLDANIKTQLTAYLEKIRQPIELVASLDGSEKAGEMWALLQDIAALSDKVSIRNDGVAPR
KPSFAVARAGEPARIRFAGIPMGHEFTSLILALLQVGGHPPKAEASTIEEIRAIPGTFHF
ETFISLSCHNCPDVVQALNLMAVLNPGISHEMIDGALFQDEVTSRQIMGVPTVLLNGEHF
GQGRMLLEEIVGKIDTGALQREAEKISAREPFDVLIVGGGPAGAAAAIYAARKGIRTGVV
SERFGGQVLDTLGIENFISVSQTDGPKLAAGLEQHVREYDVDVMDLQRAEALLPGSDGGP
SEIRLASGAKLRSQTVILATGARWREMNVPGEKEYRGHGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGVVAHVTVLEFDSILRADAILQKKLFSLANVKVITSALTTEVTGDGK
KVNGLVYTDRSSGEAHRVELEGVFVQIGLLPNTEWLKGTIALSPRGEIEIDARGETSLPG
VFAAGDVTTVPYKQIVIAMGEGAKASLSAFDYLIRSSVT
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgcaaacatcaaaacacaactcacggcctatctggaaaagatccgccagccg
atcgaactcgtcgcctcactcgacggcagcgagaaggcgggcgagatgtgggcgctgctt
caggacattgccgcgctctcggacaaggtcagcatcaggaacgatggcgttgccccgcgc
aagccttcctttgccgtcgcccgggctggcgagccggcgcgaatccgctttgccggcatc
ccgatggggcacgaattcacgtcgctgatcctggctctcctgcaggtcggcggtcatccg
ccgaaggccgaagccagcaccatcgaggaaatccgcgccattcccgggacatttcacttc
gagaccttcatctcgctctcctgccataactgccccgatgtcgtccaggcactgaacctg
atggccgtgctgaaccccggcatcagccacgagatgatcgatggcgcgctgttccaggac
gaggtgaccagccggcagatcatgggggttcccaccgttctgttgaatggcgaacacttc
ggccagggccgcatgctgctcgaggagatcgtcggcaagatcgataccggcgccctgcag
cgtgaagccgagaagatctcggcgcgcgagcccttcgacgtgctgatcgtcggcggtggc
ccggccggcgccgccgcagcgatctacgcggcccgcaaggggattcgcacgggggtggtc
agcgaacgcttcggtggccaggtgctcgacacgctggggatcgagaacttcatttccgtc
agccagaccgacggcccgaaactcgccgccgggctggagcagcacgtccgcgaatacgac
gtcgatgtcatggacctgcaacgcgccgaggcgctgctaccgggcagcgatggcgggccg
agcgaaatccgcctggccagcggcgccaagctgcgcagccagacggtgatcctcgccacg
ggcgcacgctggcgcgagatgaacgttcccggcgagaaggagtatcgcggtcacggcgtg
gcctattgcccgcactgtgacggcccgctgttcaagggcaagcgcgtggcggtgatcggc
ggcggcaactccggggtcgaggcggcgatcgaccttgccggcgtcgtcgcgcacgtcact
gtgctcgaattcgacagcattctgcgtgccgacgccatcctgcagaagaagcttttcagt
cttgccaacgtcaaggtgatcaccagcgccctgaccaccgaagtgaccggtgacggcaag
aaagtcaacggcctggtctacaccgaccgtagcagcggcgaagcgcatcgcgtcgagctc
gaaggcgtcttcgtgcagatcggcctgttgccgaataccgagtggctgaaggggacgatc
gccctctcgccacgcggcgaaatcgagatcgacgctcgcggtgagacctcgctgccgggc
gtcttcgctgccggtgatgtcacgacagtgccttacaagcagatcgtcatcgcgatggga
gaaggggccaaggcttccttgagtgccttcgattacctgattcgcagttcagtcacctga

DBGET integrated database retrieval system