KEGG   Acetobacter pasteurianus IFO 3283-22: APA22_07660Help
Entry
APA22_07660       CDS       T01815                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
apq  Acetobacter pasteurianus IFO 3283-22
Pathway
apq00020  Citrate cycle (TCA cycle)
apq00310  Lysine degradation
apq00380  Tryptophan metabolism
apq01100  Metabolic pathways
apq01110  Biosynthesis of secondary metabolites
apq01120  Microbial metabolism in diverse environments
apq01130  Biosynthesis of antibiotics
apq01200  Carbon metabolism
Module
apq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APA22_07660
  09105 Amino acid metabolism
   00310 Lysine degradation
    APA22_07660
   00380 Tryptophan metabolism
    APA22_07660
Enzymes [BR:apq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     APA22_07660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: BAI08060
LinkDB All DBs
Position
795221..798235
Genome map
AA seq 1004 aa AA seqDB search
MAFRQKGHRGRSALWGGVKKKWSGLRWRTTQYLANGAYVPRGKEECEMAVSDVLATALNG
ANIAYLADLYAQWAKDPKSVDPSFDILFSSLGDDEAAVLKDAVGASWAPRPSIITGDEPA
PAPKGKGGPAGGLAAQDSLAIARLIRAYREYGHLEASLDPLGLKVPHKTEELDPATYGFG
EKDLNREVFIGSLLDPLLKGKNTAKVSEVIAALRSVYCESIGAEYMYARNHEQREWLRKR
LEGDNWRAHVTVEEQKVILANLTEAEGFEAFCQKRYVGAKRFGLEGGEISIPSLHAIIDS
CASQGVTSVAIGMAHRGRLNTLVNVVRKPYVAIFNEFAGGSFKPDNVEGSGDVKYHLGSS
TDVDVAGKAVHISLQPNPSHLEAVDPVVCGKVRAIQDDAGDTEKRLSSLGVIIHGDAAFA
GQGIVYETFAMSQLPGYRTGGTIHMVVNNQIGFTTNPECGHSGIYGTDVAKSIEAPVLHV
NGDDAEAVIYVSRLAADYRQAFASDIVLDIVCYRRHGHNETDEPVFTQPVMYKAIAAHDT
PHTLYAKRLVKAGVVTDDEVKAQWDAFHAKLDEDYKAAQSYKVNKADWLEGGWKGLVAAG
HDPERAFPETGVALDALRKIGEAITKVPEGFNLNSKIARQLKAKANMFSTGEGFDWATGE
ALGFGSLLLDGHRVRLSGEDCQRGTFSQRHAVWTDQVNQTPFTPLNHIQDKQAKIEIWNS
LLSEYGVVGFEYGYSVRNPQTLVLWEAQFGDFANCAQVIIDQFIASGETKWLRMSGLVML
LPHGYEGQGPEHSSARLERYLQLCAENNMFVCNITTPANYFHALRRQLKLDYRKPMILME
PKSLLRHKLAVSALADFGPGTRFKPVIGEIDDLGADNKVRRVVICSGKVYYDLLAERREK
GIKDVAILRLEQLYPFPEAALAAELKRYSEADIVWCQEETENGGAWHFADRRIEAALAAA
GHKAGRPQYVGRAAAASPATGLARIHAAEQADLVERALGLKKSG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atggctttccggcaaaaaggacacaggggacgctccgcgctatggggcggagtgaagaaa
aaatggtccggtttacggtggagaacgacgcaatatctggccaacggcgcgtatgtgccc
cgtggcaaggaggaatgtgagatggcggtttcggacgtactggcaaccgctcttaacggt
gccaatatcgcttaccttgcggatctgtatgcccagtgggcgaaggatcccaaaagtgtg
gatccgtccttcgatattctgttcagctcattgggcgatgatgaagccgcagtgctgaag
gatgccgttggagcctcttgggcgccacgcccttccattatcacgggggatgaacccgca
cctgctccgaaaggaaaaggtggcccggctggtgggttggccgcgcaggatagtctggcc
attgcccggctgatccgtgcgtatcgtgaatacggccacctggaagcctcgcttgatccg
ctgggcctgaaggtgcctcataaaaccgaggaactggaccccgccacatacggttttggt
gaaaaagacctgaaccgcgaagtgtttattgggtcactgcttgatccgctgctcaagggc
aagaacacggccaaggtttccgaggttattgcggcactccgctctgtgtattgcgaaagc
attggcgcagaatacatgtatgcccgtaaccacgaacagcgcgaatggctgcgcaagcgg
ctggaaggcgataactggcgcgcccacgtaacagtggaagagcagaaggttatcttggcc
aacctgacagaagccgaaggttttgaggctttctgccagaagcgctatgtgggtgcgaag
cgttttggtctggaagggggcgaaatctccattccttccctgcacgccattattgattcc
tgtgccagccagggggtgacatctgttgccatcggcatggcgcatcgtggccgcttgaac
acgctggttaacgtggtgcgcaagccttacgtggccatctttaacgaatttgcaggtggt
tccttcaaaccagacaatgttgaaggttctggcgacgttaaataccaccttggctcctcc
acagatgtggatgtggcaggcaaggcggtgcatatctcgctccagcccaacccttctcat
ctggaagcagtggatccggttgtgtgcggcaaggtgcgcgccattcaggatgatgcgggc
gatacggaaaaacgcctgtccagccttggcgttatcatccacggtgatgccgcgtttgcc
gggcagggcattgtttacgaaaccttcgccatgtcccaactgccgggctaccgcacgggt
ggcaccatccatatggtagtgaacaaccagattggctttaccaccaatccggaatgtggg
cattcaggcatttatggcaccgatgttgcaaaatccattgaagcccctgtgctgcatgta
aacggtgatgatgccgaggcggtgatttatgtctctcgccttgctgcggattaccgtcag
gcttttgcaagtgacattgtgctggatatcgtttgctaccgtcgccacgggcataacgaa
acggatgagccagttttcactcagcccgtcatgtataaagctattgccgcgcatgatacg
ccgcacacgctttatgcaaaacgccttgtaaaagcaggcgttgtgacggatgacgaagtg
aaggcccagtgggatgctttccacgccaagctggatgaagattacaaagctgcccagtct
tacaaggtgaacaaggcagactggctggaaggtggctggaaaggcctggtggctgccggg
catgatccggaacgcgccttccccgaaaccggtgttgcactggatgcgctgcgcaagatt
ggcgaagccattacaaaagtgccagaaggcttcaacctgaattccaaaattgcccgccag
ctcaaggccaaggcaaacatgttcagcacgggtgaagggtttgactgggcaaccggtgag
gctctgggctttggctccctgttgctggatggccaccgtgtgcgtctttccggtgaagat
tgccagcgtggcacgttcagccagcgtcatgccgtatggacggaccaggttaaccagaca
ccgtttacgccgctgaaccatattcaggacaagcaggcgaaaatcgaaatctggaactcg
cttctttcagaatacggcgtggttgggtttgaatacggatattccgtgcgcaacccacaa
acgctggtgctgtgggaagcccagtttggtgattttgccaactgtgctcaggtaattatc
gatcagttcatcgcctcgggtgaaaccaagtggttgcgtatgtccggtttggtcatgctg
ctgccgcatggttacgaagggcaggggccggaacattcttctgctcgtctggaacgttat
cttcagctttgtgctgaaaataacatgtttgtttgcaacatcaccacgcccgcaaactac
ttccacgccctgcgccgccagctcaagctggattaccgcaagccgatgatcctgatggag
cccaagtctctgctgcggcacaaacttgcggtttccgctctggcagattttggtccgggc
acacgctttaaacccgtgattggcgaaattgatgatctgggcgccgataacaaggtgcgc
cgcgtggtgatctgttctggcaaggtctattatgatctgctggccgaacgccgggaaaaa
ggcatcaaggatgttgccatcctgcgtctggaacaactctaccccttcccggaagcagcc
cttgccgccgaacttaagcgctattctgaagcagacattgtctggtgtcaggaagaaacg
gaaaacggcggtgcatggcattttgcagacaggcggattgaagcagcccttgctgccgca
ggccataaggcaggccgcccgcaatatgtgggccgcgccgcagcagccagcccggccacc
ggccttgcccgtattcatgcggcagagcaggcggatctggttgaacgcgcattggggctg
aaaaagtctggctga

DBGET integrated database retrieval system