KEGG   Acetobacter pasteurianus IFO 3283-22: APA22_12570Help
Entry
APA22_12570       CDS       T01815                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
apq  Acetobacter pasteurianus IFO 3283-22
Pathway
apq00564  Glycerophospholipid metabolism
apq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    APA22_12570
Enzymes [BR:apq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     APA22_12570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: BAI08551
LinkDB All DBs
Position
complement(1317392..1318912)
Genome map
AA seq 506 aa AA seqDB search
MTTPTASPARIYDLLIVGGGVNGAGIARDAVGRGASVLLVEQDDLASYTSSSSTKLIHGG
LRYLEYYEFRLVREALMERERLLKMAPHIMWPLRFVLPHSKLVRPAWMLKAGLFLYDHLA
SNMTLPKSRGIDFRTHSSGAALKPEYTKGFVYSDGWVQDSRLVVLNAMDAAERGADVRTR
TRLIAASRANGVWEATLEDRATGKTTTVRAKALVNAAGPWVARLLADTLKIPNSKSVRLV
KGSHIIVPRVYEGPQAYIFQNPDKRIVFAIPYEQKFTLIGTTDIPWKQEPGKVEIAPDEV
SYLCESVNRYLNVQVKESDVVWSYAGLRPLYDDASANASAVTRDYVLDLDTQDGAPLLSI
FGGKITTYRKLAEHALEKLAPVLPAVGGQSWTAQEVLPGGDLGDGGFDQALARLRRTAPW
LPEGLAWRLMRNYGSRTYEIIGEANSMQDMGEVLGGDLTSREVDYLISREWARTAEDVLW
RRSKLGLHLNDAEKANVEAYVGKKLA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacctactgcatctcccgcccgcatttatgatctgctcattgttggaggaggg
gtaaacggcgcaggcatcgcacgagatgctgttggccgtggcgcctctgttctgctggtg
gagcaggatgaccttgccagctacacatcatcttccagcacaaagctgatccacggtggt
ctgcgctatctggaatattacgaattccgcctggtgcgcgaagccctgatggaacgcgaa
cgcctgttgaagatggccccgcatatcatgtggccgctccggttcgtgctgccacactcc
aagctggtgcgcccggcatggatgctcaaggctggcctgttcctttacgatcaccttgct
tccaacatgacactgccgaagtctcgcggcattgatttccgtacgcattcatccggtgca
gcgctgaagcccgaatacaccaaaggctttgtgtattccgatggctgggtgcaagacagc
cgccttgtggtgctgaacgccatggatgccgccgaacgcggtgcagatgtgcgcacacgc
acacgcctgattgccgccagccgcgccaacggcgtgtgggaagccacgctggaagaccgc
gcaaccggcaaaaccacaaccgtacgcgccaaggcgctggtaaacgctgctggcccatgg
gttgcgcgcctgctggccgatacgctgaagatcccgaactccaaatccgttcgtttggtc
aagggtagccacattattgtgccgcgcgtatatgaaggcccgcaggcttatatcttccag
aacccggataagcgtattgtgttcgccattccgtacgaacagaagttcacgctgattggc
accaccgatattccgtggaagcaggaaccgggcaaagtggaaattgcgcccgatgaagtg
agctacctgtgtgaaagcgtaaaccgctatctgaacgtgcaggtcaaagaaagcgatgtg
gtgtggagctacgctggcctgcgtccgctgtatgatgatgcctctgccaacgcttctgcc
gtaacacgtgattacgtgctggatctggatacgcaggatggtgcgccgctgctttcaatc
tttggcggcaagatcaccacttaccgtaagcttgccgaacacgcgctggaaaaactggca
cctgttctgcccgcagtaggtggccagagctggactgcacaggaagttctgcccggtggt
gacttgggtgacggtgggtttgaccaggctctggcacgcctgcgccgcacagcaccgtgg
ctaccggaaggtcttgcatggcgcctgatgcgcaattatggcagccggacctacgaaatt
attggtgaagccaatagcatgcaggatatgggtgaagtgctgggcggtgacctgacatcg
cgtgaagtggattatctgatttctcgtgaatgggcacgcacggcagaagatgttctgtgg
cgccgcagcaagctgggtctgcatctgaatgatgcagaaaaagccaatgttgaagcatat
gtcgggaagaaacttgcctga

DBGET integrated database retrieval system