KEGG   Acetobacter pasteurianus IFO 3283-22: APA22_19020Help
Entry
APA22_19020       CDS       T01815                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
apq  Acetobacter pasteurianus IFO 3283-22
Pathway
apq00473  D-Alanine metabolism
apq00550  Peptidoglycan biosynthesis
apq01100  Metabolic pathways
apq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:apq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    APA22_19020
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    APA22_19020
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    APA22_19020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apq01011]
    APA22_19020
Enzymes [BR:apq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     APA22_19020
Peptidoglycan biosynthesis and degradation proteins [BR:apq01011]
 Precursor biosynthesis
  Amino acid ligase
   APA22_19020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 B12-binding UPF0180 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: BAI09175
LinkDB All DBs
Position
2071449..2072387
Genome map
AA seq 312 aa AA seqDB search
MNAPKRVTVLMGGMSSERVVSLSSGQGVAEALRSKGYDVCTLDAQADLATLVEALNTQKP
DVVFNALHGRFGEDGCIQGILDWMGIPYTHSGIRASATAMDKAAARAIFQTAGLPVAEGM
VVDIATLAHADPLPTPYVVKPLNEGSSVGVSIVRTGSNTRADIVKNWTYGPQALVEAFIP
GREITVGVMGDRALTITDITPTGTGHDFYDYDSKYQVGGSAHVLPAQIDAASAKLALEVA
VKAHQALGCSGASRSDFRLDDTNPDQPHLILLEVNTQPGMTATSLLPEQAAYCGISYPEL
CAWLVEQATCRQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaccaaaacgcgtaaccgtgctgatgggtggcatgtcctccgaacgggtggtc
agcctttcatccggtcaaggcgtggcggaagccctgcgcagcaaagggtatgatgtctgc
acgctggatgctcaagctgatctggctacgttagttgaagcgttaaacacccaaaaaccg
gatgtggtgtttaacgccctgcatggtcgttttggtgaggatggctgtattcagggtata
ctggactggatgggtattccctacacccattcgggcattcgggcctctgctactgctatg
gataaagccgctgcccgcgctattttccaaacagccgggctgcccgtggcagaaggcatg
gtggtagatattgccacccttgctcatgcagaccccctgcctacaccttacgtggtgaag
ccgcttaatgaaggctcatccgttggggtttccattgtgcgtacgggatccaacacgcgc
gctgatattgttaaaaactggacttacggcccgcaagcgcttgtagaagcctttattccc
ggtcgtgaaattaccgtaggtgttatgggtgatcgggcgctcaccattacggatattacc
cctaccggcaccgggcatgatttttacgactatgattccaaatatcaggtcggcggctct
gcccatgttctgcctgcacaaattgatgccgccagcgccaaacttgctctggaagttgcc
gtaaaagcgcatcaggcattggggtgttctggcgcatcgcgctctgatttccggttggat
gataccaacccggatcagccacaccttattctgctggaggtcaacacgcagccgggtatg
acggccacatccctgctgcccgaacaggccgcctattgtggtatcagctaccccgaactt
tgcgcgtggttggttgaacaggctacctgccggcaatga

DBGET integrated database retrieval system