KEGG   Acetobacter pasteurianus IFO 3283-22: APA22_20770Help
Entry
APA22_20770       CDS       T01815                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
apq  Acetobacter pasteurianus IFO 3283-22
Pathway
apq00970  Aminoacyl-tRNA biosynthesis
apq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    APA22_20770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:apq03029]
    APA22_20770
Enzymes [BR:apq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     APA22_20770
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     APA22_20770
Mitochondrial biogenesis [BR:apq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    APA22_20770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAI09347
LinkDB All DBs
Position
2257548..2258909
Genome map
AA seq 453 aa AA seqDB search
MPSSFPSMLHAAHALADGRTTARELVENALAHIADSQGEGARTFMSVHATAARGHADAMD
KLRCQGQAPSPLAGLPISVKDLFDEAGSTTRAGSMVLADAPPASMDAPAIARLKQAGLIS
IGRTTMTEFAFSGIGINPHFGTPANPWRRDEKRIPGGSSSGAAVSVSDNMAFVGIGSDTG
GSCRIPAALTGLVGYKPTSSRISTQGTVPLSSTLDSIGSIGRTVACCWAADSLMATGTIR
IQDAPTGRDGHTLRLGMLSTSVMEDMDETVAHTWEDCLSRLSRNGVILETFTCPPLTEIP
KANSKGGFPAAESLAWHQHLLETRRSVYDPFVLQRILRGYEQTAVDYIALLQSRAKLIRQ
AADIMNHYDAVILPTVPIIAPKINDMNDNARYVATNLLLLRNTTIANFLDLCAISLPCHH
AGEAPVGLMVMGRHAEDCDLFHIAAQLERILAH
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgccctcttccttcccttctatgcttcatgcagcgcacgctcttgcagacggccgcaca
acggcccgagaactggtagaaaatgctctggctcacattgcagactcacagggggaaggc
gcacgtacctttatgtctgtgcatgccacggctgcgcgtgggcatgctgatgccatggat
aaattacgatgtcaggggcaagccccctctcctttagcagggcttcctatttccgttaaa
gatctgtttgatgaagcaggttccaccaccagagcaggctctatggttctagccgatgcc
ccacctgccagtatggatgcccctgctattgcgcgcctgaagcaggccgggcttattagt
attggcagaacaaccatgacggaatttgccttttcgggcattggcatcaatccgcatttt
ggcactccggctaatccgtggcgtagggatgaaaaacgcattcccggcggatcttcttca
ggagccgccgtttctgtctcggacaacatggcttttgtaggcattggaagcgataccggt
ggctcctgccgtattccagcggcactgactggccttgtcggttacaagcccacatcaagt
cggatttccacccaagggaccgtgcccctttcttccaccttagattccattggaagcatc
ggccgcacagtggcgtgctgttgggcggcagatagcctgatggcaacaggaacaattcgt
atacaagacgctccaactgggcgagacggacacactcttcggttaggtatgcttagcact
tctgtcatggaagatatggacgagacagtcgctcatacatgggaagattgtttaagcagg
ctttccagaaacggcgttatactggaaacctttacctgccctcccctcacagaaattccg
aaagccaacagcaaaggagggttccccgcagctgaatcccttgcatggcaccagcatctt
ctagaaacacgccgtagcgtttacgatccttttgtattgcagcgtattttacgaggttac
gagcagaccgctgtggattatattgccttactgcaaagtagagccaaattaatccgacag
gcagccgatatcatgaaccattatgatgctgtcattttgccaacggtgcccattattgcc
ccaaagatcaacgatatgaatgataatgcccgttacgtagcaactaatcttctgttatta
cgcaataccacgatagccaactttcttgatctatgcgccattagcctgccatgccatcac
gcaggcgaagcgcctgtgggattaatggttatgggccgtcatgctgaagactgtgatctc
ttccatattgccgcacaacttgaacgtattcttgcccactaa

DBGET integrated database retrieval system