KEGG   Anaerococcus prevotii: Apre_0047Help
Entry
Apre_0047         CDS       T00964                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
apr  Anaerococcus prevotii
Brite
KEGG Orthology (KO) [BR:apr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Apre_0047
Enzymes [BR:apr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Apre_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DAO Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored NAD_binding_7 NAD_binding_8 Thi4 FAD_binding_3 AlaDh_PNT_C FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ACV28102
UniProt: C7RF41
LinkDB All DBs
Position
complement(56541..58079)
Genome map
AA seq 512 aa AA seqDB search
MLDQNLKNQLAQYLDLLKTEVVIGLSVDDGENSKKLKGFIDDVASLSDKIKVEEKKLKYT
PSFELKGDFDHGEIVFAGLPLGHEFASFALALLQVGGVSPKLDDKSKARIEALDGKMDFE
TIVSLSCHNCPDVVQAFNIMAILNPNINHTMIEGGMFKDLAESRDVLAVPAIFKDGDFFE
GGKQSMDKILDLLGSVKDTSHFENKDIFDVLIVGGGPAAATSAIYAARKGLRTGLVASEF
GGQVNETLAIENIPGFKYTEGPDFMNQMKDQVQALGVDIMTGALAKAIKRNDKDKLIEMS
LDNDISLQAKTAILATGARWRLIGIPGETEFRNKGVAYCTHCDGPLFKDKPVAVIGGGNS
GVEAAIDLANLAKKVTVIEFLPELKADKILQDKLKSLGNVEIITNAQTTGLYGDGKVQSL
KFTDRSSGEEKEIAIDGCFIQVGLVPNTEWLTESEVQLNKHGEIITDKNGASNVEGIFAA
GDATETAFKQIVIAAGSGATAALGAFNYLMVN
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaatttaaagaaccagctagcccaatatcttgacttattaaaaacagaa
gtcgttattgggctttctgttgatgatggtgaaaattccaagaagcttaaaggctttatt
gatgacgtagcaagcctatccgataaaattaaagttgaggaaaaaaagcttaaatatact
ccttctttcgagctaaaaggagacttcgaccatggagaaattgtctttgcgggccttcct
ctaggccatgaattcgcctcctttgccctcgccctccttcaagtgggaggagttagccct
aaacttgatgataaaagtaaggctaggatagaagcccttgatggtaagatggattttgaa
actatagtttctctttcctgccacaattgcccagatgtggttcaagccttcaatataatg
gcgattctaaatccaaatattaaccacaccatgattgagggcggtatgtttaaggacttg
gcagaaagtcgtgacgtcctcgccgttcctgctatctttaaggatggagacttctttgaa
ggcggcaagcaatctatggacaagatcttagatcttttaggaagtgttaaagatacaagt
cactttgaaaataaggatatcttcgatgttctcatagtcggaggtggtcctgccgctgca
acttctgcaatttatgcagcaagaaaggggcttaggacagggcttgtggcgagtgaattt
ggtggtcaagtcaacgaaactctcgctatagaaaatattcctggctttaaatatacagaa
ggccctgacttcatgaatcagatgaaggatcaagtccaagcccttggtgtagatatcatg
acaggagctttggcaaaagctataaagaggaatgataaagataaattaattgaaatgagc
ctagataatgatatttccctacaagcaaaaacagctatccttgcgacaggagctaggtgg
agacttataggaattcctggggaaactgagtttagaaacaagggagttgcctattgcacc
cactgtgatggtcccctctttaaggataagccagtagcagtaattggaggcggcaattcc
ggagtggaagctgcaattgatcttgctaatcttgccaaaaaggttacagtaatcgaattt
ctcccagagcttaaggctgacaaaatcctccaagataagctaaaaagcctaggaaatgta
gagataataaccaacgcccaaacgaccggcctttatggagatggcaaggtccagagccta
aaatttaccgacaggtcctctggagaagagaaggaaatagcaatcgacggctgcttcatc
caagtaggccttgttcctaatacagaatggcttactgaaagtgaagtccagctaaataaa
catggcgaaataataactgacaagaatggcgcaagcaatgtcgaaggaatttttgcagca
ggagatgctacagaaactgccttcaaacaaattgtaatagctgcaggctctggtgcaaca
gcagccctcggagccttcaactacttgatggtaaactaa

DBGET integrated database retrieval system