KEGG   Anaerococcus prevotii: Apre_0667Help
Entry
Apre_0667         CDS       T00964                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
apr  Anaerococcus prevotii
Brite
KEGG Orthology (KO) [BR:apr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:apr01001]
    Apre_0667
Enzymes [BR:apr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Apre_0667
Protein kinases [BR:apr01001]
 Serine/threonine kinases: Other
  Bacterial family
   Apre_0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like FTA2 Glyco_hydro_32C Kdo RIO1
Motif
Other DBs
NCBI-ProteinID: ACV28706
UniProt: C7RGU5
LinkDB All DBs
Position
762791..764749
Genome map
AA seq 652 aa AA seqDB search
MEKIILDNRYEIIEQIGLGGMAKVYKAKDRLLDRFVAIKVLKEQYAEDEEFLKKFNNEAQ
SAAKLNHVNIVNVYDIGEDLLEGRKIYYIVMEYVEGQTLKDLIDEEGKLSNHDIIDYSVQ
IAQALKSAHASGIIHRDIKPQNILIDKFGLAKVTDFGIARVSSNATITYTSSILGTVHYI
SPEQAKGKIVDEKSDLYSLGAVMYEMATGRVPFDADNSVGIAVMHIQDKARPAKELTPDL
SDHLNFIIMKLLEKEPGNRFLNATELIDSLENQNFSNEQVLEETARIPIVVPNKGKKKKK
KAKKEVLPKSEEAVYVSPTDEVPEEKEKTKSLKIWPLALLALILVGAVYYFMSRPKDDIL
EVPTVINLSQEMAVKELEKRGLKANISRTEESDDYDKGKVMKQDPEANTEVKKGTTVNLV
ISAGREVSVPDLAGLNLTEAEEKLKELGLSIGRTSTEYSDQVEKDLIIDQNPRSATNLQA
GSKVDLVISAGPEEKIENIEVPSLIGMSEEQAASLISQYGLVLRNVDYRESEDVEKGNVI
SQSISEGTQVAPQSQIDLVISAGKKEKEKEEKTGQAKNVDLRLNINNGKDKFNVKIYKLD
DNDKRSDILYDQNQTSKDLDESQVLQLNFQAIQNTKFEVLVDDESYGVYTVN
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagataattttggacaataggtacgagattatagagcagattggccttggagga
atggctaaggtctacaaggccaaagataggctactcgatagatttgttgccattaaggta
cttaaggagcaatatgcagaagatgaggagtttctaaagaaattcaacaatgaagctcag
tctgctgcaaagcttaatcatgtcaatatagtaaatgtctacgatataggagaagacctc
cttgaaggaagaaagatttactatatagtcatggaatatgttgaagggcaaactcttaag
gatctaatagatgaagaaggaaagctttctaaccacgatataatagattattctgtacag
atagcccaagccttaaagtctgcccacgcatcaggtattatccacagggatatcaagcca
caaaacattttgatagataagtttggccttgctaaggtaacagattttggtatagcaaga
gtctcatcaaatgctaccataacatatacatcatccattctaggaacagttcattatata
tcaccagaacaagccaagggcaagattgtcgatgagaaaagcgatctgtattctcttgga
gctgtgatgtatgagatggcaactggaagggttccatttgatgcagataattctgtagga
attgctgtaatgcacattcaagataaggcaaggcctgccaaggaattaacccctgatctt
tctgatcatctaaatttcattattatgaagcttcttgaaaaggagccaggcaatagattc
ctaaatgcgacagagcttatagatagtcttgaaaatcagaatttctcaaatgagcaggtc
cttgaagagacagcgagaattccaatagttgtcccaaataagggaaagaaaaagaagaaa
aaagcaaagaaggaagttcttccaaagtcagaagaagcagtttatgtttctcctacagat
gaagtgccagaagaaaaggagaaaactaaatcacttaagatttggccactggccctactt
gcactaattttggttggggcagtgtattacttcatgtcaaggccaaaggatgatatcctt
gaagttccaacagttataaacttaagtcaagaaatggcagtaaaggaacttgaaaaaaga
ggacttaaggcaaatatttcaagaacagaagaaagcgatgactacgataagggcaaggta
atgaagcaagaccctgaggcaaatactgaagttaaaaaaggaactacagtaaatcttgta
atcagtgcgggaagagaagtgagcgtgccagaccttgctggactcaacctaacagaggca
gaagaaaaactcaaagagttgggtttaagtataggaaggacgagcacggaatatagtgat
caagtcgaaaaagacttaatcattgatcaaaacccaagatctgctacgaaccttcaagca
ggaagtaaggtcgaccttgttattagtgcagggccagaagaaaaaattgaaaacattgaa
gttccaagccttatcggtatgagtgaggaacaagcggcaagcctaatcagtcaatacgga
ctcgtccttagaaatgtagactacagggaaagtgaagatgtagaaaagggcaatgttata
agccaatctatatctgaaggaacccaagtagcaccacaatctcaaattgacctagtaatt
tctgctggtaagaaggagaaggaaaaagaagaaaagacaggccaggctaaaaacgtagat
ttaagacttaatataaataatggaaaagataaattcaacgtcaaaatttataagcttgat
gacaacgataagcgaagcgacatcttatatgaccaaaatcaaactagcaaggatttagat
gaaagccaagtcctacaactaaacttccaagcaatacaaaatactaagtttgaagtcttg
gttgatgatgaatcttacggagtgtatacagtaaattga

DBGET integrated database retrieval system