KEGG   Actinosynnema pretiosum: CNX65_02045Help
Entry
CNX65_02045       CDS       T05092                                 

Definition
(GenBank) peptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
apre  Actinosynnema pretiosum
Brite
KEGG Orthology (KO) [BR:apre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CNX65_02045
Enzymes [BR:apre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CNX65_02045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ATE52225
UniProt: A0A290YZP5
LinkDB All DBs
Position
435890..437026
Genome map
AA seq 378 aa AA seqDB search
MPGRPRTGQLLPMRTTITALAAAGLLLAAAVPARAAPAVPPLDRAALAAAVAGLPDGEAS
GALVRVSGRAGSWTGSGGVSRLGTTRPVSPEGRFRIGSATKLLTAATVLRLDERGVLDLD
DTVQQHLPDLLPAAFEPITVRQLLNHTHGIAGNGLPHKSTGWFAENRYRTWDPREVVGLG
VAKGPLHRPGAEQRYGNQGYLVAGLVIEAATGRPYADSVRELVIRPLGLRDTYLPGAETG
IRGEHSHGYQLREDGSHWDVTGANPTFQWAAAEAVSSARDLDRLINALVFGDLIGERSRA
EMLTLPLPGAAHGLGVNRIELGGVVLWGKTGDRPGYNTGVAVTEDGSRTIVYSVNTLDME
AGELPPTAERIITAALTP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgccggggaggccccggaccgggcagcttctccccatgcgcacaacgatcaccgctctg
gccgccgcagggctcctcctggcggcggcggtcccggcccgggcggcgcccgccgtcccc
ccgctcgaccgcgccgcgctggccgccgccgtggcgggcctgccggacggggaggcgtcc
ggggcgctggtccgcgtctccggccgcgcgggctcctggacgggctccggcggcgtctcc
cggctcggcacgacccgcccggtgtccccggagggccggttccgcatcggcagcgccacg
aagctcctgaccgccgccaccgtgctccgcctcgacgagcgcggcgtgctcgacctggac
gacaccgtgcagcagcacctgcccgacctgctgcccgccgcgttcgagccgatcaccgtg
cggcagctgctgaaccacacccacggcatcgcgggcaacggcctgccgcacaagagcacc
ggctggttcgccgagaaccgctaccgcacctgggacccgcgcgaggtggtggggctgggc
gtggcgaagggcccgctgcaccgccccggcgccgagcagcgctacggcaaccaggggtac
ctggtggcgggcctggtgatcgaggcggcgaccggcaggccgtacgcggactcggtgcgg
gagctggtgatccgcccgctggggctgcgcgacacctacctgcccggcgccgagaccggg
atcaggggcgagcactcgcacgggtaccagctgcgggaggacggctcccactgggacgtg
acgggggcgaacccgacgttccagtgggcggcggcggaggcggtctccagcgcgcgcgac
ctggaccggttgatcaacgcgctggtgttcggcgacctgatcggcgagcgctcgcgggcg
gagatgctgacgctgccgctccccggcgcggcgcacgggctcggcgtgaaccggatcgag
ctgggcggcgtggtgctgtggggcaagaccggcgaccggcccggctacaacacgggcgtc
gcggtgaccgaggacggctcgcgcacgatcgtctactcggtgaacaccctggacatggag
gcgggcgagctgccgccgacggccgagcggatcatcaccgcggccctgaccccctga

DBGET integrated database retrieval system