KEGG   Actinosynnema pretiosum: CNX65_02095Help
Entry
CNX65_02095       CDS       T05092                                 

Gene name
thiO
Definition
(GenBank) glycine oxidase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
apre  Actinosynnema pretiosum
Pathway
apre00730  Thiamine metabolism
apre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CNX65_02095 (thiO)
Enzymes [BR:apre01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     CNX65_02095 (thiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO 3HCDH_N NAD_binding_8 AlaDh_PNT_C Pyr_redox_2 NAD_binding_2 2-Hacid_dh_C Thi4
Motif
Other DBs
NCBI-ProteinID: ATE52234
UniProt: A0A290YZQ8
LinkDB All DBs
Position
447219..448226
Genome map
AA seq 335 aa AA seqDB search
MARKRVTVLGGGVIGLSIAWRAAQAGFAVAVRDRGSAHAGSWVAGGMLAPVSEAWPGDEA
VLALGLESIRLWPGFARELGVRLNTAGTLVTAVDAADAAVLDQHAAHLAAHGLEFQVLGA
AGLREREPGLGPSVRSGLNIPGDLAVSARTLLAALRTACAEAGVRFTGVAESEVDGSTTV
IAAGAWSAELHPALRDVIHPVKGEILTLLARPGALEAPERTIRAQVRGRAVYLVPNETRS
GLLVGATQYEAGFDPTVRVRGVLDLLTDAEEVWPALTEYALAETSVGFRAGSRDNTPLID
WLEPGVLAATGHHRNGVLLAPVTARRVVELLGEAA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgcaagcgagtgaccgtcctcggcggcggtgtcatcgggttgtcgatcgcctgg
cgggcggctcaggccgggttcgccgtcgcggttcgcgatcgggggtccgcgcacgcgggc
tcgtgggtggcgggcgggatgctcgcgccggtcagcgaggcgtggcccggtgacgaggcg
gtgctcgcgctcggcctggagtcgatccgcctgtggcccggcttcgcccgcgagctgggc
gtgcggctcaacaccgcgggcaccctcgtcaccgccgtcgacgccgccgacgccgccgtc
ctcgaccagcacgccgcgcacctcgccgcccacggcctggagttccaggtgctcggtgcg
gccgggctgcgcgagcgggaaccggggctcggtccgtccgtccggagtggactgaacatc
cccggcgacctcgccgtctccgcccgcaccctcctcgccgccctgcggaccgcctgcgcc
gaggcgggcgtgcgcttcaccggcgtcgccgagtccgaagtggacggttcgaccaccgtc
atcgccgccggggcctggagcgccgagctgcaccccgccctgcgcgacgtgatccacccc
gtcaagggcgagatcctcaccctcctcgcccgacccggcgcgctcgaagcccccgagcgc
accatccgcgcccaggtgaggggtcgcgccgtctacctggtcccgaacgagacccgctcc
ggcctgctcgtcggcgccacccagtacgaggccgggttcgacccgaccgtccgcgtgcgc
ggcgtcctcgacctgctcaccgacgccgaggaggtctggcccgccctcaccgagtacgcg
ctcgccgagacctccgtcggcttccgcgcgggcagccgcgacaacaccccgctgatcgac
tggctcgaacccggcgtcctcgccgccaccggccaccaccgcaacggcgtcctgctcgcc
cccgtcaccgcgcgccgcgtcgtggagctgctcggggaggcggcgtga

DBGET integrated database retrieval system