KEGG   Actinosynnema pretiosum: CNX65_03070Help
Entry
CNX65_03070       CDS       T05092                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
apre  Actinosynnema pretiosum
Pathway
apre00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:apre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CNX65_03070
Enzymes [BR:apre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CNX65_03070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 DUF3459 Glyco_hydro_35 DUF5619 Tachylectin
Motif
Other DBs
NCBI-ProteinID: ATE52399
UniProt: A0A290Z0B3
LinkDB All DBs
Position
656980..659013
Genome map
AA seq 677 aa AA seqDB search
MTSWPTGLPGLAWGADYNPEQWPEEVWDADVELMRASGVNLVSLGIFSWALLEPREGERD
FAWLDRAMDRLAEGGIRVDLATATAAPPPWMTTDHPEVRPVREDGVRLTHGSRQAYCPTS
EVYRTRAVALARALAERYRDHPALSAWHVGNEYGCHVPRCYCDNCAEAFRTWLRERYGDL
DGLNEAWGTLFWSQRYSAWEQVVPPRVTPTFGNPGQLLDFNRFASDALLELFKAERDVLH
EVTPGVPVTTNFMVGWTFADLDYWAWAKEMDFVSNDHYTRSEDPDRHIELAMAADLTRGL
AGGRPWLLMEQSTSAVNWQPRNIAKLPGEQRRNSFSHVARGADGTLFFQWRQSKAGAERF
HSAMVPHGGEDTRVHREVRRVGAEYAKLDELLGSTVDASVAIVYDWHSRWSLGQEATPTA
DFSYQENVFGLYRALWRSGVTVDFVPPGADLSGYKAVVVPSLFLLDDAEWLTSYTGHLLV
THLTAITDTRGHVHLGGYPGLIGGLLGVRTEEFHPLRAGEVVRLDDGGEVAVWTELLRSE
GAEVLSRYADGPLAGEPAVTRNGNAWYLGCGLRGAALETLVCSVVADAGVERVLVTDQGG
GADVGAGSAGVEVVRRRGDGGSWLVAINHGGEPALVPARGVELLSGDDVGGTLTVPAGGV
VVVREAAAGEPAVAEGE
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgacgagctggccgaccggactgccgggcctcgcctggggcgccgactacaaccctgag
cagtggcccgaggaggtctgggacgccgacgtcgagctgatgcgcgcgtccggcgtgaac
ctcgtgagcctcgggatcttctcctgggcgctgctggagccccgcgagggcgagcgcgac
ttcgcctggctcgaccgggccatggaccgcctcgccgagggcgggatccgggtcgacctg
gccaccgccaccgccgcgcccccgccctggatgaccaccgaccaccccgaggtccgcccg
gtccgcgaggacggcgtccgcctcacccacggctcccgccaggcctactgccccacctcc
gaggtctaccgcacccgcgccgtcgcgctggcccgcgcgctggccgagcgctaccgcgac
caccccgcgctgtccgcctggcacgtcggcaacgagtacggctgccacgtcccgcgctgc
tactgcgacaactgcgccgaggcgttccgcacctggctgcgcgagcgctacggcgacctc
gacggcctcaacgaggcctggggcaccctgttctggtcccagcgctacagcgcgtgggag
caggtcgtgccgccccgcgtgacccccacgttcggcaaccccggccagctgctcgacttc
aaccgcttcgcctccgacgcgctcctcgagctgttcaaggccgagcgggacgtgctgcac
gaggtcacccccggcgtgcccgtcaccaccaacttcatggtcggctggaccttcgccgac
ctggactactgggcgtgggccaaggagatggacttcgtctccaacgaccactacacccgc
tccgaggaccccgaccggcacatcgagctggccatggccgccgacctcacccgcggcctc
gcgggaggccgcccgtggctgctcatggagcagtccacctcggcggtgaactggcagccc
cgcaacatcgccaagctccccggcgagcagcgccgcaactccttctcgcacgtcgcgcgc
ggcgccgacggcacgctgttcttccagtggcgccagtcgaaggcgggcgccgagcgcttc
cactcggcgatggtcccgcacggcggcgaggacacccgcgtgcaccgcgaggtgcgccgc
gtcggcgccgagtacgccaagctggacgagctgctcgggtccaccgtggacgcctccgtc
gcgatcgtctacgactggcactcgcgctggtccctcggccaggaggccacccccaccgcc
gacttctcctaccaggagaacgtcttcggcctgtaccgggcgctgtggcgctccggcgtc
accgtcgacttcgtgccccccggcgcggacctgtccgggtacaaggccgtcgtcgtgccc
tcgctgttcctgctcgacgacgccgagtggctcacctcctacaccggccacctgctggtc
acccacctcaccgcgatcaccgacacgcgcggccacgtgcacctgggcggctaccccggt
ctcatcggcgggctgctcggcgtgcgcaccgaggagttccacccgctgcgcgcgggcgag
gtcgtccggctcgacgacggcggcgaggtcgccgtgtggaccgagctgctgcgctccgag
ggcgccgaggtgctctcccgctacgccgacggccccctcgcgggtgaaccggccgtcacc
cgcaacggcaacgcctggtacctcgggtgcggtctgcgcggcgcggcgctggagaccctg
gtgtgctccgtggtggcggacgcgggcgtcgagcgggtcctggtgaccgaccagggcggc
ggcgcggacgtcggcgccggttcggcgggcgtcgaggtcgtgcgcaggcgcggcgacggc
ggctcgtggctggtcgcgatcaaccacggcggcgagcccgccctggtgcccgcgcgcggc
gtggagctgctgtccggcgacgacgtcggcgggacgctcaccgtcccggcgggcggcgtg
gtcgtggtcagggaagccgccgccggggaaccggccgtcgcagaaggggagtga

DBGET integrated database retrieval system