KEGG   Actinosynnema pretiosum: CNX65_05190Help
Entry
CNX65_05190       CDS       T05092                                 

Definition
(GenBank) IMP dehydrogenase
Organism
apre  Actinosynnema pretiosum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ATE52755
UniProt: A0A290Z1A2
LinkDB All DBs
Position
1127799..1128833
Genome map
AA seq 344 aa AA seqDB search
MRATTIHGARDIRVEEVPDPVIQLPTDAVVRVELACVCGSDLWGYRGVSKRAQGQRIGHE
FVGEVVEVGSEVSTLSVGDRVIAPFCWSDGTCAHCVAGLQTSCPEGGSWGSKGSDGGQGE
AVRVPHADGTLVPVPRDADQSLLPALLSLSDVMGTGHHAALAAGVGRGSTVVVVGDGAVG
LCGVLAASRLGAERIISLGRHEDRAAVARLFGATDQVPERGEAAVERVRELTGGLGAPAV
LECVGNEQSWRTALGAVRDGGRIGYVGVPHEAPAPPIGELFRRNVALAGGVAPVRAHLPE
LLADVLAGRLDPSPVFDRTVALADVAEGYRAMDERTALKVLVRP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggcgaccacgatccacggtgcacgggacatccgagtcgaggaggtccccgacccg
gtgatccagctccccaccgacgccgtcgtgcgggtcgagctggcgtgcgtgtgcggcagc
gacctgtggggctaccggggcgtgtccaagcgcgcccagggccagcgcatcggccacgag
ttcgtcggcgaggtggtcgaggtcggctccgaggtgtcgacgctcagcgtcggcgaccgg
gtcatcgccccgttctgctggagcgacggcacctgcgcgcactgcgtcgcgggtctccag
acctcctgccccgagggcggctcgtggggctcgaagggctccgacggcggtcagggcgag
gcggtccgcgtcccgcacgccgacggcaccctcgtgcccgtgccgcgcgacgccgaccag
tccctcctgcccgccctgctgtccctgtccgacgtcatgggcaccggccaccacgcggcg
ctcgccgcgggcgtcggccggggctccacggtcgtcgtggtcggcgacggcgcggtcggc
ctgtgcggcgtgctggccgcgagcaggctcggcgcggagcggatcatctcgctgggcagg
cacgaggaccgggccgccgtggcccggctgttcggcgccaccgaccaggtgcccgagcgc
ggcgaggcggccgtggagcgggtcagggagctgaccggcgggctcggcgcgcccgccgtg
ctggagtgcgtcggcaacgagcagtcctggcgcaccgcgctcggcgcggtgcgcgacggc
ggccggatcggctacgtcggcgtcccgcacgaggcccccgccccgccgatcggcgagctg
ttccgccgcaacgtcgccctcgcgggcggggtcgccccggtccgcgcccacctgcccgag
ctgctggcggacgtgctcgcgggccgcctcgacccgtccccggtgttcgaccgcacggtc
gcgctggccgacgtcgccgagggctaccgcgccatggacgagcgcaccgcgctcaaggtc
ctcgtccggccctga

DBGET integrated database retrieval system