KEGG   Actinosynnema pretiosum: CNX65_07670Help
Entry
CNX65_07670       CDS       T05092                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
apre  Actinosynnema pretiosum
Pathway
apre00071  Fatty acid degradation
apre00280  Valine, leucine and isoleucine degradation
apre00281  Geraniol degradation
apre00362  Benzoate degradation
apre00592  alpha-Linolenic acid metabolism
apre01100  Metabolic pathways
apre01110  Biosynthesis of secondary metabolites
apre01120  Microbial metabolism in diverse environments
apre01130  Biosynthesis of antibiotics
apre01212  Fatty acid metabolism
Module
apre_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:apre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CNX65_07670
   00592 alpha-Linolenic acid metabolism
    CNX65_07670
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CNX65_07670
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    CNX65_07670
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CNX65_07670
   00642 Ethylbenzene degradation
    CNX65_07670
Enzymes [BR:apre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     CNX65_07670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ATE53182
UniProt: A0A290Z2F9
LinkDB All DBs
Position
complement(1681703..1682923)
Genome map
AA seq 406 aa AA seqDB search
MAAPAAQARVRNVVFVDGVRTPFGKAGPKGIFAETRADDLVVKVIRELLRRHPELPPERV
DEVAIAATTQIGDQGLTIGRTAALLAGLPKSVPGYSIDRMCAGAMTAVTTAASGIAFGAY
DVAIAGGVEHMGRHPMGEGVDPNPRFLSDKIVDPSALIMGSTAENLHDRYPAITKERADA
YAAASQAKYADALKNGKIDPDLVPVATRSAEHGWGLATADEPPRPGTSVADLAKLKTPFR
PHGRVTAGNAAGLNDGATGCILAGEDTAEELGLPVGMRLVGYSFLGVEPEVMGVGPVPAT
EKALRRAGLTIDDIGLFEINEAFAVQVLAFLDHFGIADDDPRVNQWGGAIAVGHPLASSG
VRLMTQLSRQFAERPDVRYGITTMCIGIGMGGTVIWENPRWNGEAK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcaccagcagcgcaggcgcgcgttcgcaacgtggtcttcgtcgacggcgtgcgc
acgccgttcggcaaggccggcccgaaggggatcttcgcggagacccgcgccgacgacctg
gtggtcaaggtcatcagggagctgctgcgccgccaccccgagctccccccggagcgcgtc
gacgaggtcgccatcgcggccaccacccagatcggcgaccagggcctgaccatcggccgg
accgccgccctgctggcgggcctgcccaagtcggtgcccggctactcgatcgaccggatg
tgcgcgggcgcgatgacggccgtgaccaccgcggccagcggcatcgcgttcggcgcgtac
gacgtggcgatcgcgggtggcgtcgagcacatgggccgccacccgatgggcgagggcgtc
gacccgaacccgaggttcctgtcggacaagatcgtcgacccgtcggccctgatcatgggt
tcgacggcggagaacctgcacgaccgctacccggccatcaccaaggagcgggccgacgcc
tacgcggcggcctcgcaggccaagtacgcggacgcgctcaagaacgggaagatcgacccg
gacctggtcccggtcgccacccgctccgccgagcacggctggggcctggccaccgccgac
gagccgccccgccccggcaccagcgtggcggacctggcgaagctcaagaccccgttccgc
ccgcacggccgggtgacggcgggcaacgcggccgggctgaacgacggcgccaccggctgc
atcctcgccggtgaggacaccgccgaggagctgggcctgccggtcgggatgcgcctggtc
ggctactcgttcctgggcgtggagcccgaggtcatgggcgtgggcccggtgcccgcgacc
gagaaggccctgcggcgcgccggtctgacgatcgacgacatcggcctgttcgagatcaac
gaggcgttcgcggtgcaggtcctggcgttcctggaccacttcggcatcgccgacgacgac
ccccgcgtcaaccagtggggcggcgcgatcgcggtcggccacccgctggcgtcctcgggc
gtgcggctgatgacccagctgtcccgccagttcgccgagcgccccgacgtgcgctacggc
atcaccaccatgtgcatcggcatcggcatgggcggcaccgtgatctgggagaacccccgc
tggaacggagaggccaagtga

DBGET integrated database retrieval system