KEGG   Actinosynnema pretiosum: CNX65_07840Help
Entry
CNX65_07840       CDS       T05092                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
apre  Actinosynnema pretiosum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ATE53211
UniProt: A0A290Z2D8
LinkDB All DBs
Position
complement(1718509..1719585)
Genome map
AA seq 358 aa AA seqDB search
MPLPLTPPVQPMLATSADAIPTTSDLLFEPKWDGYRCLVFRDGADVVLQSRGGKPLNRYF
PEVEAALRDSALPDRVVLDGELVVSLDGRLDFDALTERIHPAASRVALLSERTPAGFVAF
DLLALGDEVLLDRPTSDRRAALEEVITPSGSLHLTPCTGDVGLARRWFGLFEGAGLDGVV
GKPVAGAYLPGKRAMVKVKHARTAECVVAGLRWHKDTEPGTAVGSLLLGLHDDAGVLHHV
GVVGSFKAAERRALAEELSPLITGGEHPWVGQSDGRRSPGEENRWRKQSDWTPLTPERVL
EVSYSQTEGAAPARLRHNGRFRRWRPDRDAASCRYDQLDQPARYDLAAVLRGEVRQAR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctcccgctgaccccgcccgtgcagccgatgctggccacgagcgcggacgccatc
cccaccacctcggacctgctcttcgagcccaagtgggacggctaccgctgcctggtgttc
cgcgacggggccgacgtggtgctccagtcccgcggcggcaagccgctgaaccggtacttc
cccgaggtcgaggccgccctgcgcgactccgcgctcccggaccgcgtggtcctggacggc
gagctggtcgtctccctggacgggcggctcgacttcgacgccctcaccgagcggatccac
ccggcggcgagccgggtcgcgctgctgtccgagcggaccccggcggggttcgtcgcgttc
gacctgctcgcgctcggtgacgaggtgctgctcgaccggcccacgtccgaccgccgggcg
gccctcgaggaggtcatcacgccgtccggctcgctgcacctgaccccgtgcaccggggac
gtcgggctcgcgcggcgctggttcggcctgttcgagggcgcgggcctggacggggtggtc
ggcaagccggtggcaggcgcctacctgccgggcaagcgggccatggtgaaggtcaagcac
gccaggaccgccgagtgcgtggtcgccgggctgcgctggcacaaggacaccgaacccggc
acggcggtcggctccctgctgctcggcctgcacgacgacgccggggtgctgcaccacgtg
ggcgtggtcggctcgttcaaggcggccgagcgccgggcgctggccgaggagctgtccccg
ctgatcaccgggggcgagcacccctgggtggggcagtcggacgggcgccgctcgccgggg
gaggagaaccgctggcgcaagcagtccgactggaccccgctgacccccgagcgcgtcctg
gaggtctcctacagccagaccgagggcgccgcccccgcccgcctgcgccacaacgggcgg
ttccgccgctggcgccccgaccgggacgccgcctcctgccgctacgaccagctcgaccag
cccgcccggtacgacctggccgccgtgctgcgcggcgaggtcaggcaggcccgctag

DBGET integrated database retrieval system