KEGG   Actinosynnema pretiosum: CNX65_10000
Entry
CNX65_10000       CDS       T05092                                 

Definition
(GenBank) nucleotidyl transferase
  KO
K20427  valienol-1-phosphate guanylyltransferase [EC:2.7.7.91]
Organism
apre  Actinosynnema pretiosum
Pathway
apre00525  Acarbose and validamycin biosynthesis
apre01100  Metabolic pathways
apre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apre00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    CNX65_10000
Enzymes [BR:apre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.91  valienol-1-phosphate guanylyltransferase
     CNX65_10000
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3
Other DBs
NCBI-ProteinID: ATE53584
UniProt: A0A290Z3M5
LinkDB
Position
2231969..2233075
AA seq 368 aa
MTADVRAALLAGGLGERMGRLTDRTCKPLVPYAASCRLVDFSVANAVRSGIPELVLMSLH
RERDLIDHLRRNWDGNGLRVHFGPHDALVRSGHDGPLPERPPERGTADALLANAEHVFAP
GARDVLVQHADHVYDLDYGPMVAAHRAADADVTIGVQRIERRYVSLFGMVEVDDALAVRR
LVEKPRNPTSDLVFTAFCLFKADVLERVLTELDAQPQDAWQHDISRDVLPHMIAQGHRVL
AHPISCYWADVGTVARYREEHLKLLTTPSPLPPDALPRTLAGEPPRFDPLTGSLLPHRLP
DGVDLRGVDLRDSVVFPGAVVEPGALVHGSVLLPGAVVPAGVAARDTVVDDHLAESREGV
SALEPANR
NT seq 1107 nt   +upstreamnt  +downstreamnt
gtgaccgccgacgtccgcgccgccctgctcgccggaggtctcggcgagcgcatgggcagg
ctcaccgaccgcacctgcaaaccgctggtgccgtacgcggcctcgtgcaggctggtcgac
ttcagcgtcgccaacgcggtccgctcgggcatccccgagctggtgctgatgtcgctgcac
cgcgagcgcgacctgatcgaccacctgcgccgcaactgggacggcaacggcctgagggtc
cacttcggaccgcacgacgccctggtccgctccggccacgacggcccgctgcccgagcgc
ccgccggagcgcggcacggcggacgccctgctggccaacgccgagcacgtgttcgcgccg
ggcgcgcgggacgtcctggtgcagcacgccgaccacgtctacgacctggactacggcccg
atggtcgcggcccaccgggcggcggacgcggacgtcacgatcggcgtgcagcgcatcgag
cgccgctacgtgtccctgttcggcatggtcgaggtggacgacgccctggccgtgcgcagg
ctcgtggagaagccgcggaacccgacctcggacctggtgttcaccgcgttctgcctgttc
aaggcggacgtgctggagcgggtgctgaccgagctggacgcgcagccgcaggacgcctgg
cagcacgacatcagccgcgacgtcctgccgcacatgatcgcgcagggccaccgcgtcctg
gcgcacccgatctcctgctactgggccgacgtgggcaccgtcgcccgctaccgcgaggag
cacctgaagctgctgaccaccccgtccccgctcccgcccgacgccctgccgaggaccctg
gcgggcgagccgccgcgcttcgacccgctgaccggcagcctgctcccgcaccgcctcccg
gacggcgtcgacctgcgcggcgtcgacctgcgcgacagcgtcgtgttccccggcgcggtg
gtcgaaccgggcgcgctcgtgcacggctcggtgctcctgcccggcgcggtggtcccggcg
ggcgtggcggccagggacaccgtggtcgacgaccacctggccgagtcccgcgagggggtg
agcgccctggaaccggccaaccgctga

DBGET integrated database retrieval system