KEGG   Actinosynnema pretiosum: CNX65_13650Help
Entry
CNX65_13650       CDS       T05092                                 

Definition
(GenBank) beta-ketoacyl synthase
Organism
apre  Actinosynnema pretiosum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C KAsynt_C_assoc PP-binding adh_short Thiolase_N Epimerase GDP_Man_Dehyd Polysacc_synt_2 3Beta_HSD NmrA RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ATE54206
UniProt: A0A290Z5B6
LinkDB All DBs
Position
3094367..3115624
Genome map
AA seq 7085 aa AA seqDB search
MSQPENAEPATTAAPLARLAGLPPAEQERVLLGVVHEQVVAVLKAALPDAPDRVAPERPF
KELGFDSLAAVDLHRRLCAATGLELPVTLVFDHPTPLAVARLARRLALGERAVPVVREPV
ARRERDDEPIAIVGIGCRYPGGSDTPEKLWDVVAGGRHVISDFPDDRGWDLDALFDPEPG
KSGKSYVRKGGFLAEAAEFDAAFFGISPREALAMDPQQRLVLETAWEALEHAGVDPLSLR
GSRTGVYIGVEPQEYGPRLHQAPEGLDGYLLTGNAPSVVSGRLAYSLGLEGPTVSIDTAC
SGSLVALHLAVRALRDGDCTTALAGGVAVMVHPGAFTAFSTQRGLAPDGVCKPFAAAADG
TGWAEGVGVVVLERLSDALRAGHRVLGVVKGTAVNQDGASNGLTAPSGPAQQRVIRQALA
DAGLSTSDVDTVEAHGTGTRLGDPIEAQALLATYGQDRETPLWLGSIKSNIGHSQAAAGV
AGLIKVVYAMRERVLPRTLHVDAPSPHVDWSAGDIELLTEQRPWDSPDRPRRAGISSFGV
SGTNAHVVIEEPPAVEPVAPAKPAKATRKSKKAKATAPVPVPLVLSGRGEAALRGQAARL
AGFLTGDAAPDLVDTAHELALRRAALEHRAVLHATDRADALRGLAALAAGQDAPGLVRGS
ATAGPTAFLFTGQGSQRLSAGRELYRAHPVFAKALDAACGWLDLQLDRPLGEVMFAEPGT
EAAALLHRTAYAQSALFALETALYRLVESWGLRPDYVAGHSLGGITAAHVAGVLSLEDAA
LLVGARGRLMQALPEGGAMVSVRAPESDVLPLLEGREAEVRVAAVNGPAATVISGVETAV
LEIAQVLADRGVKTKRLTVSHAFHSPLMEPALADFRRVAEVMTYSAPAIPVVSDVTGELA
TAEQLRSPEYWVDHVRQAVRFRDVVAELAARGVATFLELGPDAVLTAMAQDCVAEIEDTD
FAFAALLRRDRDEVAEVRSAVALAHTRGQAVRWAELLPQGSGARVDLPRYAFQRERYWLT
GGSSSGGAVELGQLAADHPLVGAVVGLAGGDRVVLTGRVSPRTHPWLADHVISGSVLLPG
TAFVELAVRAGDEVGCGVLEELTLEAPLVLPERGGVVLQVVVDAPDDGGRRTVAVHSRPE
HAPEDAGWTRHAGGVLSAQAPEPGERLETWPPRDAEPVDASTAYADLAALGYGYGPVFQG
LRKAWRRGTGPSAEVYAEVALPESVAASAASFGLHPALLDAALHAVDVAGTAPGDPGEVR
VPFAWNDVVLHATGASAVRVRISPAGSDAVSLTITDPAGAPVATVGSFVSRAVTAEQLAA
ARREHHESLLRQEWVSRPVPSGPVRPATVLGAGHADLAALGAALSSGATVPETVVHHVPT
STGDVLADVRAALDSVLTVVRQWLADERFGPSRLVVVTRGVRDADLAHTPVWGLVRAAQA
ENPDRFTLVDLDDAPESAAQLLPAVATGEPELSVRAGKVSVPRLARVPVEEPADDPWAGE
GTTLVTGGTGGLGALVAKHLAARGARRLVLTSRRGPDAPGATELVAELADLGATARVVAC
DVADRAAVADLLDGITDLTAVVHTAGVVADGTVGALTAERVDEVLRPKADAAWHLHELTQ
GRDLTAFVLYSSLAALLDNPGQGNYAAANLFLNALAERRRAEGLPATALTWGLWLGESGM
GSVLDTAALHRIEASGMPGLTPEENLALLDAALTTTEPVLAPVRLDLTALRARQDGVPAL
LRVLAPTAARRAAGGAAQSGGDSLGARLAELPEADRDRVLLDLVRAHVAAVLGHGGGDAI
EPKRAFSEIGFDSLAAVELRNRLTTATGLRLPATLVFDYPTPLALVGHLKDKALGDRAAA
APVQRATATAVDDEPIAVVGMSCRFPGGVTTPEELWRLVADGVDGISRFPDDRGWDVDSL
YDPEPGKPGRTYSVEGGFLDDALDFDAEFFGISPREATAMDPQQRLLLETAWEALERAGI
DPTSLKGSPTGVFAGIMYHDYALRLKDIPEDLAGYLGNGSLASVASGRVAYVLGLEGPAV
SVDTACSSSLVSIHLAAQALRGGECSLALAGGVTVMATPDTFLDFSLQRGLAADGRSKSF
SADADGTAWGEGVGVLVLERLSDARRNGHEVLAVVKGSAINQDGASNGLTAPNGPSQQRV
IRAALSMAGLSHTEVDAVEAHGTGTRLGDPIEAQALLATYGQDRTEPLWLGSIKSNVGHT
QAAAGVAGVIKMVMAMREGVLPRTLHVGERTPQVDWSEGAVELLTEARPWPETGRPRRAG
VSSFGISGTNAHVVLEQAPAAEPAALDPAAPDATEPQPSGLVPWALSARTGDALREQAAR
LREHVGSASPRDVGWSLATTRAALERRAVVVGEDADQLDAALSALASGEAAASVVDGEAL
SDPRVVFVFPGQGSQWAGMAVELLDSSPVFAERMRECAAALAPHVDWNLVDVVRDAPGAP
PLNRVDVLQPVLWAITVSLAELWKHHGVRPDAVVGHSQGEIAAAVVSGALSLQDGAAIVA
LRSVLIGEELSGKSGMLSIQLPLDEVLPRLREGLTIGALNGARSVVVSGDPENLAALQAE
LTAEGVRARPVKIDYASHSPHVEVIRERLLAVIAHVAPRAATTPFCSTVTGGFLDGARLD
ADYWYSNLREKVDFVGATRALLGSGHTVFIECSPHPVLPSAVQETADEDDREVVTVPTLR
REDGGPRRLLLSLAQAWTRGVDVDWTTLLTGPAAPRRVALPTYAFQHRRFWLDATDGPGD
VSSAGLGATGHPLLGATTTTAENDGVLLTGRLALDTHPWLADHAASGVVLLPGTAFVELA
VRAGDQVGCDRVDELTLEAPLVLPARGGTVLQVAVGAPDATGRRAVSVHSRPEDADSSWT
RHASGFLDHAPRTSPERLTAWPPPGAAKLDVDALYAELAAGGYAYGPVFRAVRAAWRQGD
VVFAEVALPEHADAAGFGLHPALLDAALHATGAREGGAEDGLIDLPFAWTGVTLHASGAT
GLRVRLTPEGGGAVSLLLADPTGAPVATVDALVTRPIPAEALTGGSGQDSLYRVDWTPVP
AAGPVTGAVTVLDGPDLSALTQVPDWVVLPVSGQAARSTVDDVLSVLRQWIADERFAAAR
LALVTTGGVPAAGHAVDPVVAPVWGLVRAAQAENPDRFTLLDLDDANDVASAVTTPLGLG
EPEVAVRDGALLVPRLARVTDRPQAPFAWTAEDTVLITGGTGGLGALLAGHLAGQGVRQL
VLTSRRGPDAPGATELVAELADLGATARVVACDVADRDSVAALLADVDGLTAVVHTAGAL
ADGLVSAMTPEQVDAVWLPKAEGARTLHELTSDLRAFVVFSSAAGVVDGTGQGNYAAANT
YLDALVEQRRATGLPGTSIAWGLWEHRSGMTGHLTEGDLARMARSGVRGLPAAEGLALFD
AALALDAPLLVPVKLDLAALRTRGEELPRLFHGLVRPTRRAATAAGADRTPRDELLGLSA
EDRGRVLLDLVRSHVAAVLGHGSGAEIEPRRAFGELGFDSLAAVELRNRLTTATGLRLPA
TLVFDHPTPVALVAHLSESLGGAAPSAPTPVATTRADDGDPIAIVAMGCRYPGDVTTPEE
LWRLVADGVDAIGGFPVDRGWDTDGIYDPEPGKPGRTYVREGGFLSDALGFDAGFFGISP
REALAMDPQQRLLLETAWEVIERAGIDPTSLKGTPTGVFAGVMYHDYGSRLKEVPEDLAG
YLGNGSIASVLSGRVSYVLGLEGPAVSVDTACSSSLVSIHLAAQALRAGECSLALAGGVT
VMSAPDTFVDFSLQRGLARNGRSKSFSADADGTGWGEGVGLLLLERLSDARRNGHEVLAV
LRGSAVNQDGASNGLTAPNGPSQQRVIRAALANAGLSHTEVDAVEAHGTGTPLGDPIEAQ
ALLATYGQDREIPLLLGSIKSNFGHTQAAAGVAGVIKMVMAMREGRVPATLHVSERTDQV
DWSEGAVELLTEARPWPETGRPRRAGVSSFGISGTNAHIVLEQAPEPVAGTTAPETTAPE
TVAPEAIEPNGALLPLLVSGRGADAVRAQAGLLAAHLAAHPDLAPLDVAHSLVTTRAALE
QRAVVVGEDLERLTAGLSALASGEAAASVVDGEVLSDPRVVFVFPGQGSQWVGMAAELLD
ASPVFAARMAECARALSEFVDWDLIAVARGDEDAPSLERVDVVQPVLWAMMVSLAELWRA
NGVRPDAVVGHSQGEIAAAVASGALSTRDGAAIVALRSLAIAEDLAGKGGMLSVQLPVDE
VRPRLAEGLSIAVVNGARSVVVSGDPAGLDALQAELRAEGARAKRVPVDYASHSAHVESI
RERLLDVLADLSPRTSATPFCSTVTAEFTDTAALDAGYWYTNLRETVDFVGATRTLLATG
HAVFVECSPHAVLTSAVLETAEEDGREVAAIGSLRRDDGGPRRVLLSLAQAWTRGVDVDW
TGLLADRATAAPKRIALPTYAFQHRRYWLDATSATGDVTSAGLAATAHPLLGATIAVAGA
DEVLLTGRLAADTHPWLAHHAFAGATLLPGTAFVELAIRAGDQVGCDRVDELTLEAPLAL
PERGGVHVQLRIGDPDRDGGRELTVHSRAEGSEAPWTRHATGRLVRSETTPDFDLVAWPP
PGAQPVDLDGAYPALDAQGYGYGPAFQGLRAAWRLGDEVFAEVELPEDVDPAGYGLHPAL
LDAALHPVLVVESGEDRPPQLPFSWTGVSLFAEGARALRVRLTPTGGDGLAIRVADQAGN
PVAQVADLLSREVVVPAAGVPDALFRVDWTKIEAAPTTGKLLVLGDALGKYVPKVPDLAS
IGADVPEWVVLPIGSAESSRSAVDLALSTAQEWLADDRFASSTLVVLTRGGAGVGDVPVD
PAVTAVHGLIRAAAAENPDRFALVDTDGWPVHWDGLLAALGSGEPEIAVRGDDLLAPRLV
RATPEGPAFAWTDQDTVLITGGTGGLGAVLARHLVQRGVRELVLTSRRGPDAPGAAELVA
ELADLGATARVVACDVADRDSVAALLAGVDGLTAVVHTAAVLDDGLVTGLTPERLDAAWN
PKAEGARHLHELTGDLRAFVLFSSAAGVYDGAAQGNYAAANTYVDGLARARRDAGLPAVS
LAWGFWSQRSGMTDHLSDVDLARMGRSGVTGLSTEEGLALFDASLASTEPLLVPMRLDLA
ALRERDALPALLKSLVRKQVRRSGVTGEEDGGSALARRLRALPPADRTRVVLDLVRSHVA
AVLGHDGAASVDPRRAFRDLGFDSLAAVELRNRLVAATGLRLPATLVFDHPNPELLAALL
ETELVGDAEPAADLPAAPTRAVDDDPIAVVGIGCRFPGDVSTPEDLWRLLDGGVDAISAF
PTDRGWDLDALFDPEPGKVGKSCSLEGGFLHDAADFDAGFFGISPREALATDPQQRLLLE
TAWEALERAGIDPVSLRGSATGVFAGVMYNDYATRLRSVPEDLAGYVGNGSLGSVASGRV
SYVLGLEGPAVSVDTACSSSLVSLHLAAQALRAGECSLALAGGVSVMATPDTFIDFSLQR
GLAPGGRAKSFSADADGTAMSEGVGMLVLERLSDARANGHEVLAVLRGSAVNQDGASNGL
TAPNGPSQQRVMRSALAVAGLRPSEVDAVEAHGTGTVLGDPIEAQAVIATYGQDRDEPLW
LGSIKSNIGHTQAAAGVAGVIKMIMAIRAGVLPRTLHADQRTDRVDWSGGAVELLTEPRP
WPETDHPRRAGVSSFGISGTNAHVIVEQAPTAPTTSAQDAPTRAVPAPIVLAAADEGALR
AQAENLLALLADGVDRTDLAHATATTRAALEHRAAIVPGDPAEVLKSLEALAATGSGPGV
VRTARSTGALALLFTGQGAQRAGMGRELRAAWPVFAEAFDEACALLDAELDTPLAQVLDG
DDPDLVQQTRYSQPALFAFEVALHRLLRSWGVRADLLAGHSIGELAAAHVAGVFSLADAA
RLVAARGRLMQSMRPDGGMVSVLATEERVRADLVGLEGRVDVAAVNGPASTVVSGDADAL
AELVATWKAEGLKTRALAVSHAFHSPHTDEVLDAFREVATSIAYAEPTTPVVSTLTGRLA
EPGELTDPEYWVRHVRGAVRFHDAVRELEARGATTFLEVGPDAVLTALGRDCLLDEGAAL
LTATQRADHPETTALAAAVGALFVRGTTPDWAALFAGSGARPVDLPTYPFQRRRYWLDAA
VGGTGSGSGHPLAGDVLTTAEGDGVLLTGRISPRTHAWLADHTVSGEVLLPGTAFVELAV
QAGDQVGCGRVEELTLQSPLVLPERGGVVLQVAVGGPDESGRRTVTAHSRPDAEGAQWTR
HATGSLVPDTEVATTDADLTGEPGRWAPPDATELDLTGHYAELAARGYGYGPAFQGLRAA
WRRGDEVFAEVALPEEVDASGYGLHPALLDATLHTAELLEDGPGELTVPFAWKDVVLRAT
GASALRVRLTRTGPTAYSVALADPDGAPVAEVGSLAVRPLPAAEGPSVGDALFRLDWTPV
LGAADTPARLAVLGAPGRFPAEVAYPDLDAVAAAGPQGPDSVLLPLPATGDDPAAAGRAA
VEGLLPVLRRWAEDDRLAGKRLVVVTTGAVSVDGEDSPGLAHAALWGLLRSAQVEHPDLV
GLVDVDGDPASDLVLPAALTAGEPQLAVRGGRAFAPRLVRAGLPAAAPDFGSGRVLVTGG
LSGVGATVARHLVTARGVTDLLLTSRRGQDAPGAAELVAELTGLGASVEVAACDVADRDA
VAALLEGLELSAVVHSAGVVDDALLSGLTPEQVAAVWRPKAEAAWHLHELTRGHDLTAFV
LFSSLVSVVGGAGQSAYAAANGFLDALAAHRRAQGLPATSVAWGLWTGVGSAMTGELGER
DLRRMASSGVLGLRPAEGLALLDAAVASDRADLVAARLDLAAVRQASGAVPPVFRALVRG
AVRRVAGTGAPTSGPSVAEQVAALPPARRRDHLVELVRGLVAGVLGHDGAHAVDAGKGFL
ELGFDSLAAVELRNRVAEVVGVRLSATLVYDHPTPAAVAELLLSELGGAEESAPSLEAEL
ARLETALETAAPDEEERVRVESRLRALVARWSGAGGAVAEAADVLDAVTADELFDILDEE
LEATD
NT seq 21258 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcccgagaacgccgagcccgccaccaccgcagcgcccctggcgcggttggcc
gggctgccaccagcggagcaggagcgcgtcctgctcggcgtcgtgcacgagcaggtcgtc
gcggtgctcaaggccgccctgcccgacgcccccgaccgggtcgcccccgagcgccccttc
aaggagctgggcttcgactcgctggccgccgtggacctgcaccgcaggctgtgcgccgcc
accggcctcgaactgccggtcaccctggtcttcgaccaccccaccccgctcgccgtggcc
cgcctcgcgcgccgcctggcgctgggcgagcgcgccgtcccggtcgtgcgggagccggtc
gcgcggcgcgagcgggacgacgagcccatcgcgatcgtcggcatcggttgccgctacccc
ggcggcagcgacacccccgagaagctgtgggacgtcgtcgcgggcggcaggcacgtcatc
tccgacttccccgacgaccggggctgggacctggacgcgctgttcgaccccgagcccggc
aagtccggcaagtcctacgtgcgcaagggcggcttcctcgccgaggccgccgagttcgac
gccgcgttcttcggcatcagcccgcgcgaggcgctcgccatggacccgcagcagcgcctg
gtcctggagaccgcgtgggaggcgctggagcacgcgggcgtcgacccgctgtccctgcgc
ggcagccgcaccggcgtgtacatcggcgtcgagccccaggagtacgggccgcgcctgcac
caggcccccgagggcctggacggctacctgctcaccggcaacgcgcccagcgtcgtctcc
gggcgcctcgcctactcgctgggcctggaagggcccaccgtctcgatcgacaccgcctgc
tccggctcgctcgtggcgctgcacctcgcggtgcgggcgctgcgcgacggcgactgcacc
accgcgctcgcgggcggcgtcgcggtcatggtgcaccccggcgcgttcaccgcgttcagc
acccagcgcggcctcgcgcccgacggcgtgtgcaagcccttcgccgccgccgccgacggc
accggctgggccgagggcgtcggcgtggtcgtgctggagcggctgtccgacgcgctgcgc
gcgggccaccgcgtgctcggcgtcgtcaagggcaccgccgtgaaccaggacggcgcctcc
aacggcctgaccgcgcccagcggtcccgcgcagcagcgcgtcatccgccaggcgctcgcc
gacgccggactgtccacctcggacgtcgacaccgtcgaggcgcacggcaccggcacccgc
ctgggcgacccgatcgaggcgcaggcgctgctcgccacctacggccaggaccgcgagacc
ccgctgtggctgggctcgatcaagtccaacatcggccacagccaggccgccgcgggcgtc
gcgggcctgatcaaggtcgtgtacgcgatgcgcgagcgggtcctgccgcgcaccctgcac
gtggacgccccgagcccgcacgtggactggtccgccggtgacatcgagctgctgaccgag
cagcgcccgtgggactcgcccgaccggccgcgccgcgcgggcatctcctcgttcggcgtc
agcggcaccaacgcgcacgtcgtgatcgaggagcccccggccgtcgaaccggtcgcgccc
gcgaagcccgccaaggccacccggaagtccaagaaggccaaggccaccgcgcccgtcccg
gtcccgctggtgctctccgggcggggcgaggccgcgctgcgcggccaggccgcccggctc
gccgggttcctcaccggtgacgccgcccccgacctggtcgacaccgcccacgagctggca
ctgcgccgcgccgccctggagcaccgcgcggtcctgcacgccaccgaccgcgccgacgcc
ctgcgcggcctcgccgccctcgccgccgggcaggacgcccccggcctggtgcgcggctcc
gccacggcgggcccgaccgcgttcctgttcaccggccagggcagccagcgcctgtcggcg
ggccgcgagctgtaccgcgcccacccggtgttcgccaaggcgctcgacgcggcctgcggc
tggctcgacctccagctcgaccgccccctcggcgaggtgatgttcgccgagcccggcacc
gaggccgccgctctgctgcaccgcaccgcctacgcgcagagcgccctgttcgccctggag
accgccctctaccggctggtcgagtcctggggcctgcgccccgactacgtcgcgggccac
tcgctgggcggcatcaccgccgcgcacgtcgcgggcgtgctgtccctggaggacgccgcg
ctgctcgtcggcgcgcgcggcaggctcatgcaggcgctgcccgagggcggcgccatggtg
tcggtgcgcgcccccgagtccgacgtgctgccgctgctggagggccgcgaggccgaggtg
cgcgtggccgccgtcaacgggcccgccgccaccgtgatctccggcgtggagaccgccgtc
ctggagatcgcccaggtcctggccgaccggggcgtgaagaccaagcggctcaccgtctcg
cacgccttccactcgccgctgatggaaccggcgctggccgacttccgccgcgtcgccgag
gtcatgacctactcggcgcccgccatcccggtggtctccgacgtcaccggcgagctggcc
accgccgagcagctgcgctccccggagtactgggtcgaccacgtccggcaggccgtccgg
ttccgcgacgtggtcgccgagctcgccgcgcgcggcgtcgccaccttcctcgaactcggc
cccgacgccgtcctcaccgccatggcgcaggactgcgtggccgagatcgaggacaccgac
ttcgccttcgccgccctgctgcgccgcgaccgcgacgaggtcgccgaggtccgctccgcc
gtcgcgctcgcgcacaccaggggccaggccgtgcgctgggccgagctgctcccgcagggc
tccggcgcgcgcgtcgacctgccccgctacgccttccagcgcgagcgctactggctcacc
ggcggcagctcctcgggcggcgcggtcgagctgggccagctcgccgccgaccacccgctc
gtcggcgccgtcgtcggcctcgcgggcggcgaccgggtcgtgctcaccggccgggtctcc
ccgcgcacccacccgtggctggccgaccacgtcatctccggctcggtcctgctgcccggc
accgcgttcgtggagctggccgtgcgcgcgggcgacgaggtcggctgcggcgtgctcgag
gagctgaccctggaagccccgctggtgctgcccgagcgcggcggcgtcgtgctccaggtc
gtcgtggacgcccccgacgacggcggtcgtcgcaccgtggccgtgcactcgcggcccgag
cacgcccccgaggacgcgggctggacccgccacgcgggcggcgtgctgtccgcgcaggcc
ccggaacccggcgagcgcctggagacctggccgccgcgcgacgccgaaccggtcgacgcc
tccaccgcgtacgccgacctcgccgcgctgggctacggctacggcccggtgttccagggc
ctgcgcaaggcgtggcggcgcgggaccggcccctccgccgaggtgtacgccgaggtggcg
ctgcccgagtcggtcgccgcgtccgccgcctccttcggcctgcaccccgcgctgctcgac
gccgccctgcacgccgtggacgtcgcgggcacggcgcccggcgaccccggcgaggtgcgc
gtcccgttcgcctggaacgacgtcgtcctgcacgccaccggcgcgtcggcggtgcgcgtg
cgcatcagccccgccgggtccgacgcggtgtcgctgaccatcaccgacccggcgggcgcg
ccggtcgccacggtcggctcgttcgtctcccgcgcggtcaccgccgagcagctcgccgcc
gcccgccgcgagcaccacgagtcgctgctgcgccaggagtgggtctcgcggcccgtcccg
tccggcccggtccgcccggccaccgtgctcggcgcgggccacgccgacctcgccgcgctg
ggcgccgccctctcctcgggcgcgaccgtgcccgagaccgtcgtccaccacgtcccgacg
agcaccggtgacgtcctcgccgacgtccgcgccgcgctcgactcggtgctcaccgtggtc
cgccagtggctcgccgacgagcgcttcggcccgtcccgcctggtcgtggtcaccaggggc
gtccgcgacgcggacctcgcgcacaccccggtgtggggcctggtccgcgccgcgcaggcg
gagaacccggaccgcttcaccctggtcgacctggacgacgcccccgagtccgccgcccag
ctgctcccggccgtcgccaccggcgagccggagctgtccgtgcgcgcgggcaaggtctcc
gtgccgcgcctggcgcgcgtcccggtcgaggagcccgccgacgacccgtgggcgggcgag
ggcaccaccctggtcaccggcggaaccggcggcctcggcgcgctggtcgccaagcacctg
gccgccaggggcgcccggaggctggtgctcaccagccgccgcggccccgacgcgcccggc
gcgaccgagctggtcgcggagctggccgacctcggcgcgaccgcccgcgtggtggcctgc
gacgtggccgaccgcgccgccgtcgccgacctgctcgacggcatcaccgacctgaccgcc
gtcgtgcacaccgccggtgtcgtcgcggacggcacggtcggcgccctcaccgccgagcgc
gtggacgaggtgctgcgccccaaggccgacgccgcctggcacctgcacgagctgacccag
ggccgcgacctgaccgcgttcgtcctgtactcctcgctggccgcgctgctcgacaacccc
ggccagggcaactacgccgccgcgaacctgttcctcaacgcgctggccgagcgccgccgc
gccgagggcctgcccgccaccgccctcacctggggcctgtggctgggggagagcggcatg
ggctcggtgctcgacaccgccgccctgcaccgcatcgaggcctccgggatgccgggcctg
acccccgaggagaacctggcgctgctcgacgccgcgctcaccaccaccgagccggtgctc
gccccggtccgcctcgacctgaccgcgctgcgcgcccgccaggacggcgtcccggccctg
ctgcgcgtcctcgcccccaccgccgcgcgccgcgccgccgggggagcggcccagtccggc
ggcgacagcctcggcgcgcgcctggccgagctgcccgaggccgaccgggaccgcgtcctg
ctcgacctggtccgcgcgcacgtcgcggcggtcctgggccacggcggcggcgacgccatc
gagcccaagcgcgcgttcagcgagatcggcttcgactcgctggcggccgtggagctgcgc
aaccgcctcaccaccgccaccggcctgcggctgcccgcgaccctggtgttcgactacccg
accccgctcgccctggtcgggcacctgaaggacaaggcgctcggcgaccgcgccgccgcc
gcgcccgtccagcgcgccaccgccaccgcggtggacgacgagcccatcgccgtcgtcggc
atgagctgccgcttccccggcggcgtcaccacccccgaggagctgtggcgcctggtcgcc
gacggcgtcgacggcatctcccgcttccccgacgaccggggctgggacgtcgactcgctc
tacgaccccgagcccggcaagcccggccgcacctactcggtcgagggcggcttcctggac
gacgcgctggacttcgacgccgagttcttcggcatcagcccgcgcgaggccaccgcgatg
gacccgcagcagcgcctgctgctggagaccgcctgggaggcgctggagcgcgcgggcatc
gacccgacctcgctcaagggcagcccgaccggcgtgttcgcgggcatcatgtaccacgac
tacgccctgcggctgaaggacatcccggaggacctggccgggtacctgggcaacggctcg
ctcgccagcgtcgcctccggccgcgtcgcgtacgtgctcggcctcgaaggcccggccgtc
tccgtggacaccgcgtgctcctcgtcgctggtgtcgatccacctggccgcgcaggccctg
cgcggcggcgagtgctcgctcgccctggccggtggtgtcaccgtcatggccacgcccgac
acgttcctggacttcagcctccagcgcggcctggccgccgacggccgctccaagtcgttc
tccgccgacgccgacggcaccgcctggggcgagggcgtgggcgtgctcgtgctggagcgg
ctgtccgacgcgcgccgcaacggccacgaggtcctggccgtggtcaagggctccgcgatc
aaccaggacggcgcgtccaacggcctgaccgcccccaacgggccgtcgcagcagcgggtc
atccgcgccgcgctgtccatggcgggcctgtcgcacaccgaggtcgacgccgtcgaggcg
cacggcaccggcacccgcctgggcgacccgatcgaggcgcaggcgctgctggccacctac
ggccaggaccgcaccgagccgctgtggctgggctcgatcaagtcgaacgtcggccacacc
caggccgcggccggtgtcgcgggcgtcatcaagatggtcatggcgatgcgcgagggcgtg
ctgccccgcaccctgcacgtgggggagcgcaccccgcaggtcgactggtccgagggcgcg
gtcgagctgctcaccgaggcccgcccgtggccggagaccggccgtccgcgccgcgcgggc
gtgtcctcgttcggcatcagcggcaccaacgcgcacgtcgtgctggagcaggcccccgcc
gccgaacccgccgcgctcgaccccgccgcgcccgacgccaccgaaccgcagccgtccggc
ctggtgccgtgggcgctgtccgcccgcaccggggacgccctgcgcgagcaggccgcccgg
ctgcgcgagcacgtcggctcggcgtccccgcgcgacgtcggctggtccctggccaccacc
cgcgccgcactggagcgccgcgccgtcgtggtcggcgaggacgccgaccagctcgacgcc
gcactgtccgcgctggcctccggcgaggccgcggcgtccgtcgtggacggcgaggcgctg
tccgacccgagggtcgtgttcgtcttccccggccagggctcgcagtgggcgggcatggcc
gtggagctgctcgactcctccccggtgttcgccgagcggatgcgcgagtgcgccgccgcg
ctggccccgcacgtggactggaacctggtcgacgtcgtgcgcgacgcccccggcgcgccg
ccgctgaaccgggtggacgtgctccagccggtgctgtgggcgatcaccgtgtccctggcg
gagctgtggaagcaccacggcgtgcgccccgacgcggtcgtcggccactcccagggcgag
atcgccgccgccgtcgtctccggcgcgctgtccctgcaggacggcgccgcgatcgtcgcg
ctgcgcagcgtcctgatcggcgaggagctgtccggcaagagcgggatgctgtccatccag
ctgcccctggacgaggtcctgccgcgcctgcgcgagggcctgaccatcggcgcgctcaac
ggcgcccgctcggtcgtggtctccggcgacccggagaacctggccgcgctccaggccgag
ctgaccgccgagggcgtgcgcgcccgcccggtcaagatcgactacgcctcgcactccccg
cacgtggaggtgatccgcgagcggctgctggccgtgatcgcgcacgtcgccccgcgcgcc
gccaccaccccgttctgctccaccgtcaccggcggcttcctcgacggcgcgaggctcgac
gccgactactggtactccaacctgcgcgagaaggtcgacttcgtcggcgccacccgcgcc
ctcctcggctccggccacaccgtgttcatcgagtgcagcccgcaccccgtgctgccctcg
gccgtgcaggagaccgccgacgaggacgaccgcgaggtcgtcaccgtcccgaccctgcgc
cgcgaggacggcggcccccgcaggctgctgctgtccctggcccaggcgtggacgcgcggc
gtcgacgtggactggaccaccctgctcaccggcccggccgccccgcgccgcgtcgccctg
cccacctacgccttccagcaccgccgcttctggctcgacgccaccgacggccccggcgac
gtctcgtcggcgggcctgggcgccaccggccacccgctgctgggcgcgaccaccaccacc
gccgagaacgacggcgtcctgctcaccggccgcctcgcgctcgacacccacccgtggctg
gccgaccacgccgcctccggcgtcgtcctgctgcccggcaccgcgttcgtggagctggcg
gtccgggcgggcgaccaggtcggctgcgaccgcgtggacgagctgaccctggaggccccg
ctggtgctgcccgcgcgcggcggcaccgtcctgcaggtcgcggtcggcgcgcccgacgcc
accggaaggcgcgcggtgagcgtgcactcccggcccgaggacgccgactcctcgtggacc
cggcacgcctccggcttcctggaccacgccccgcgcaccagccccgagcgcctgaccgcg
tggccgccgcccggcgcggccaagctcgacgtcgacgccctctacgcggagctcgcggcg
ggcggctacgcctacggcccggtgttccgcgccgtccgcgccgcctggcggcagggcgac
gtggtgttcgccgaggtcgcgctgcccgagcacgccgacgcggcgggcttcggcctgcac
ccggcgctgctcgacgcggccctgcacgccaccggcgcccgcgagggcggggccgaggac
ggcctgatcgacctgccgttcgcctggaccggcgtcaccctgcacgcctccggcgcgacc
gggctgcgcgtgcggctcacccccgagggcggcggcgcggtgtcgctgctgctggccgac
ccgaccggcgcgccggtcgccacggtcgacgcgctggtcacccggcccatcccggccgag
gcgctgaccggcggctccggccaggactcgctctaccgcgtggactggaccccggtcccg
gcggcgggcccggtcaccggcgcggtcaccgtgctggacggccccgacctgtccgcgctg
acgcaggtcccggactgggtggtgctgccggtctccggccaggccgcgcggtccaccgtg
gacgacgtgctctccgtgctgcgccagtggatcgcggacgagcggttcgccgccgcccgc
ctcgccctggtcaccaccgggggcgtgcccgccgcgggccacgccgtcgacccggtcgtc
gccccggtgtggggcctggtccgggccgcgcaggcggagaacccggaccggttcaccctg
ctcgacctggacgacgcgaacgatgtggccagcgccgtcaccaccccgctcggcctgggc
gagccggaggtcgcggtccgcgacggcgcgctcctcgtgccgcgcctggcccgcgtcacc
gaccgcccccaggccccgttcgcctggaccgccgaggacaccgtcctgatcaccggcggc
accggcggcctcggcgcgctgctcgcgggccacctggccgggcagggcgtgcggcagctg
gtgctcaccagccgtcgcggcccggacgcgcccggcgcgaccgagctggtcgccgagctg
gccgacctgggcgccaccgcccgcgtcgtcgcctgcgacgtggccgaccgcgactcggtc
gccgcgctcctcgccgacgtcgacggcctcaccgccgtcgtgcacacggcgggcgcgctc
gccgacggcctcgtctcggccatgacccccgagcaggtcgacgccgtctggctgcccaag
gccgagggcgcgcgcaccctgcacgagctcacctccgacctgcgggcgttcgtcgtcttc
tcctcggcggcgggcgtggtcgacggcaccggccagggcaactacgccgccgccaacacc
tacctcgacgcgctggtggaacagcgccgcgccaccggtctgcccggaacctcgatcgcc
tggggcctgtgggagcaccgcagcggcatgaccggccacctcaccgagggcgacctggcc
cgcatggcccgctccggcgtgcgcggcctgcccgccgccgagggcctcgccctgttcgac
gccgccctcgcgctcgacgccccgctgctggtcccggtgaagctggacctggcggccctg
cgcaccaggggggaggagctgccccggctgttccacggcctggtccgccccacccgccgc
gccgcgaccgccgcgggcgccgaccggaccccgcgcgacgagctgctcggcctgtccgcc
gaggaccggggccgcgtcctgctcgacctggtccgctcgcacgtcgcggccgtcctcggc
cacggcagcggcgccgagatcgagccgcgccgcgcgttcggcgagctgggcttcgactcg
ctcgcggcggtcgagctgcgcaaccggctcaccaccgccaccggcctgcggctgcccgcc
accctggtgttcgaccacccgaccccggtcgcgctggtcgcgcacctgtccgagtcgctc
ggcggggccgcgcccagcgcgcccaccccggtggcgacgacccgcgcggacgacggcgac
ccgatcgccatcgtcgcgatgggctgccgctaccccggcgacgtcaccacccccgaggag
ctgtggcggctcgtcgcggacggcgtcgacgcgatcggcgggttccccgtcgaccggggc
tgggacaccgacggcatctacgaccccgaaccgggcaagcccggccgcacctacgtgcgc
gagggcggcttcctcagcgacgccctgggcttcgacgccgggttcttcggcatctccccg
cgcgaggccctggccatggacccgcagcagcggctgctgctggagaccgcgtgggaggtc
atcgagcgggcgggcatcgacccgacctcgctcaagggcaccccgaccggcgtgttcgcc
ggcgtgatgtaccacgactacggcagcaggctgaaggaggtccccgaggacctggccggg
tacctgggcaacggcagcatcgccagcgtcctgtccggccgcgtgtcctacgtgctcggc
ctcgaaggcccggcggtctccgtggacaccgcgtgctcctcgtccctggtgtccatccac
ctggccgcgcaggcgctccgggcgggggagtgctcgctcgccctcgccggcggcgtcacg
gtgatgtccgcgccggacaccttcgtggacttcagcctccagcgcggcctggcccgcaac
ggccggtccaagtcgttctccgccgacgccgacggcaccggctggggcgagggcgtcggc
ctgctcctgctggagcggctgtccgacgcgcgccgcaacggccacgaggtgctggcggtg
ctgcgcggcagcgcggtcaaccaggacggcgcgtccaacggcctcaccgcccccaacggc
ccgtcgcagcagcgcgtcatccgcgcggcgctggccaacgcgggcctgtcgcacaccgag
gtcgacgccgtcgaggcgcacggcaccggcaccccgctcggcgacccgatcgaggcgcag
gcgctgctggccacctacggccaggaccgggagatcccgctgctgctgggctccatcaag
tccaacttcggccacacccaggccgcggcgggcgtcgcgggcgtcatcaagatggtcatg
gcgatgcgggagggccgggtcccggccaccctgcacgtctccgagcgcaccgaccaggtc
gactggtccgagggcgcggtcgagctgctcaccgaggcccgcccgtggccggagaccggt
cgtccgcgccgcgccggtgtctcgtcgttcggcatcagcggcaccaacgcgcacatcgtc
ctggagcaggcccccgagccggtcgccgggaccaccgcgccggaaaccaccgcgccggaa
accgttgcgccggaagcgatcgagcccaacggggcgctgctgcccctgctggtctccggt
cgcggcgcggacgcggtgcgcgcccaggccgggctgctcgccgcccacctggccgcccac
cccgacctcgcgccgctcgacgtcgcgcactccctggtcaccacccgcgccgcgctggag
cagcgcgccgtcgtggtcggcgaggacctggagcggctcaccgccgggctgtccgcgctg
gcctccggcgaggccgccgcgtccgtcgtggacggcgaggtgctctccgacccgagggtc
gtgttcgtcttccccggccagggctcgcagtgggtcggcatggccgccgagctgctcgac
gcctcaccggtcttcgccgcccgcatggccgagtgcgcgcgggccctgtccgagttcgtg
gactgggacctgatcgccgtggcgcgcggcgacgaggacgccccctcgctggagcgggtc
gacgtcgtgcagccggtgctgtgggcgatgatggtgtcgctggccgagctgtggcgcgcg
aacggcgtgcgccccgacgcggtcgtcggccactcgcagggcgagatcgccgccgccgtc
gcgtccggcgcgctgtccactcgggacggtgcggcgatcgtggcgctgcgcagcctcgcc
atcgccgaggacctggcgggcaagggcgggatgctgtccgtgcagctgcccgtggacgag
gtccgcccccggctcgccgagggcctgtcgatcgcggtggtcaacggcgcccgctccgtc
gtcgtctccggcgacccggccgggctggacgcgctccaggccgagctgcgcgccgagggc
gcgcgggccaagcgggtcccggtggactacgcctcgcactccgcccacgtggagtcgatc
cgcgagcgcctgctcgacgtgctcgcggacctgtccccgcgcacctccgccaccccgttc
tgctccacggtcaccgccgagttcaccgacaccgccgcgctcgacgccggctactggtac
acgaacctgcgcgagacggtcgacttcgtcggcgccacccgcaccctgctcgccaccggg
cacgccgtgttcgtcgagtgcagcccgcacgcggtgctcacctcggcggtgctggagacc
gccgaggaggacggccgcgaggtcgccgcgatcggctccctgcgccgcgacgacggcggc
ccccgccgggtgctgctgtccctggcccaggcgtggacgcgcggcgtcgacgtggactgg
accggcctgctcgcggaccgcgcgacggcggccccgaagcggatcgccctgcccacctac
gccttccagcaccgccgctactggctcgacgccacctcggcgaccggcgacgtcacctcg
gcgggcctggccgcgaccgcccacccgctgctcggcgcgaccatcgccgtcgcgggcgcg
gacgaggtcctgctcaccggccgcctcgccgccgacacccacccgtggctggcgcaccac
gccttcgcgggcgccaccctgctccccggcaccgcgttcgtggagctcgcgatccgggcg
ggcgaccaggtcggctgcgaccgcgtggacgagctgaccctggaggccccgctggcgctg
cccgagcgcggcggcgtgcacgtccagctccgcatcggcgaccccgaccgggacggcggc
cgggagctgaccgtgcactcccgcgccgagggctccgaggccccgtggacccggcacgcc
accggccgcctggtccgctccgagaccaccccggacttcgacctggtggcctggccgccg
cccggcgcgcagccggtggacctggacggcgcctacccggcgctcgacgcccagggctac
ggctacggccccgccttccagggcctgcgcgccgcctggcggctcggcgacgaggtgttc
gccgaggtcgagctgcccgaggacgtggacccggcgggctacggcctgcaccccgccctg
ctcgacgccgccctgcacccggtgctggtggtcgagtccggcgaggacaggccgccgcag
ctgccgttctcctggacgggcgtgtcgctgttcgccgagggcgcccgcgccctgcgggtg
cggctcaccccgaccggcggcgacggcctggccatccgggtcgccgaccaggcgggcaac
cccgtcgcccaggtcgccgacctgctctcccgcgaggtcgtcgtgcccgcggcgggcgtg
ccggacgcgctgttccgggtggactggaccaagatcgaggccgcgccgaccaccggcaag
ctgctcgtgctcggcgacgcgctgggcaagtacgtgcccaaggtccccgacctggcctcg
atcggcgcggacgtccccgagtgggtcgtgctgccgatcggctcggccgagtcctcccgc
tccgccgtcgacctggccctgtccaccgcgcaggagtggttggccgacgaccggttcgcc
tcctcgacgctcgtggtgctcaccaggggcggcgcgggggtcggcgacgtgccggtcgac
ccggccgtcaccgccgtgcacggcctgatccgggccgccgccgccgagaaccccgaccgg
ttcgcgctggtggacaccgacggctggccggtgcactgggacgggctgctcgccgcgctg
ggctccggcgagccggagatcgcggtgcgcggcgacgacctgctcgccccgcgcctggtc
cgcgccacccccgagggccccgcgttcgcctggaccgaccaggacaccgtcctgatcacc
ggcggcaccggcggcctcggcgcggtgctggccaggcacctggtgcagcggggcgtgcgg
gagctggtgctcaccagccgccgcggccccgacgcccccggcgcggcggagctggtggcg
gagctggccgacctgggcgccaccgcccgcgtcgtcgcctgcgacgtcgccgaccgcgac
tcggtcgccgccctgctcgcgggcgtcgacggcctcaccgccgtcgtgcacaccgccgcc
gtgctggacgacggcctggtcaccggcctcacccccgagcgcctggacgccgcctggaac
cccaaggccgagggcgcgcggcacctgcacgagctgaccggcgacctgcgggcgttcgtg
ctgttctcctccgccgcgggcgtctacgacggcgcggcccagggcaactacgccgccgcc
aacacctacgtcgacggcctcgcgcgggcccgccgcgacgcggggctgccggccgtctcg
ctcgcctggggcttctggtcccagcgcagcggcatgaccgaccacctgtccgacgtcgac
ctggcccgcatgggccgctccggcgtcaccggcctgagcaccgaggagggcctcgcgctg
ttcgacgccagcctcgcctcgaccgagccgctgctggtgccgatgcgcctcgacctggcc
gcgctgcgcgagcgcgacgcgctgcccgcgctgctgaagtccctggtgcgcaagcaggtc
cgccgctccggcgtcaccggcgaggaggacggcggctccgcgctggcccgcaggctccgc
gcgctgcccccggccgaccggacccgcgtggtgctggacctggtgcgctcgcacgtcgcg
gccgtcctcggccacgacggcgcggcgtccgtcgacccgcgccgcgcgttccgcgacctg
ggcttcgactcgctcgccgcggtcgagctgcgcaaccgcctggtcgcggccaccggcctg
cggctgcccgcgaccctggtgttcgaccacccgaacccggagctgctggccgccctgctg
gagaccgagctggtcggcgacgccgagcccgccgccgacctgcccgccgcgcccacccgc
gcggtggacgacgacccgatcgcggtcgtcggcatcggctgccgcttccccggcgacgtc
agcacgcccgaggacctgtggcggctgctcgacggtggcgtcgacgccatcagcgcgttc
ccgaccgaccgcggctgggacctggacgccctgttcgacccggagcccggcaaggtcggc
aagtcctgctccctggagggcggcttcctgcacgacgccgccgacttcgacgccgggttc
ttcggcatcagcccgcgcgaggccctggccaccgacccgcagcagcgcctgctgctggag
accgcgtgggaggccctggagcgggccgggatcgacccggtgtcgctgcgcggcagcgcg
accggcgtgttcgcgggcgtgatgtacaacgactacgcgacccgcctgcggtcggtgccc
gaggacctggccgggtacgtcggcaacggcagcctgggcagcgtcgcctccggccgggtg
tcctacgtgctgggcctggagggcccggccgtctcggtcgacaccgcgtgctcctcctcg
ctggtctccctccacctggccgcgcaggcgctcagggcgggggagtgctcgctggcgctg
gcgggcggcgtgagcgtcatggccacgccggacacgttcatcgacttcagcctccagcgc
ggcctggcgccgggcgggcgggcgaagtcgttctccgccgacgcggacggcaccgcgatg
tccgagggcgtcgggatgctggtcctggagcggctctccgacgccagggccaacgggcac
gaggtgctggcggtgctgcgcggcagcgcggtcaaccaggacggcgcgtccaacggcctg
accgcgcccaacgggccgtcgcagcagcgggtcatgcgctccgcgctggccgtcgcgggc
ctgcggccgtccgaggtggacgcggtcgaggcgcacggcaccggcacggtgctcggcgac
ccgatcgaggcccaggccgtcatcgccacctacggccaggaccgcgacgagccgctctgg
ctgggctcgatcaagtccaacatcggccacacccaggccgcggcaggcgtcgcgggcgtg
atcaagatgatcatggcgatccgggcgggcgtgctgccccgcacgctgcacgccgaccag
cgcaccgaccgggtcgattggagcgggggcgcggtcgagctgctgaccgagccccggccg
tggccggagaccgaccacccgcgccgcgcgggcgtctcctccttcggcatcagcggcacc
aacgcgcacgtcatcgtcgagcaggccccgaccgcgccgaccacgtccgcccaggacgcg
cccaccagggccgtgcccgccccgatcgtgctggccgccgccgacgagggcgccctgcgc
gcccaggcggagaacctgctggcgctgctcgcggacggcgtcgaccggaccgacctggcc
cacgccaccgccaccacccgcgcggcactggagcaccgcgcggcgatcgtccccggcgac
cccgccgaggtgctcaagtccctggaagccctggccgccaccggttccgggccgggcgtc
gtgcgcaccgcccgctccaccggggcgctcgccctgctgttcaccgggcagggcgcgcag
cgcgcgggcatggggcgcgagctgcgcgccgcctggccggtgttcgccgaggcgttcgac
gaggcgtgcgcgctgctcgacgccgagctggacaccccgctcgcccaggtcctggacggc
gacgacccggacctggtgcagcagacccgctacagccagcccgccctgttcgccttcgag
gtcgccctgcaccgcctgctccggtcctggggcgtgcgcgcggacctcctcgcgggccac
tcgatcggcgagctggccgcagcccacgtcgccggggtgttctccctggccgacgcggcc
aggctggtcgccgcgcgcggcaggctcatgcagtccatgcgccccgacggcggcatggtc
tcggtcctggccaccgaggagcgcgtccgcgccgacctcgtgggcctggagggccgggtc
gacgtggccgccgtgaacggccccgcctcgaccgtcgtctccggcgacgccgacgcgctg
gccgaactggtggcgacctggaaggccgagggcctcaagacccgcgccctcgccgtgtcc
cacgccttccactccccgcacaccgacgaggtgctcgacgcgttccgcgaggtcgccacg
agcatcgcctacgccgagccgaccacccccgtggtctccaccctcaccggccgcctcgcc
gaacccggcgagctgaccgacccggagtactgggtgcggcacgtgcgcggcgcggtgcgc
ttccacgacgccgtgcgcgagctggaggccaggggcgccaccacgttcctggaggtcggc
ccggacgcggtgctcaccgcgctcggccgcgactgcctgctcgacgagggcgccgcgctg
ctgaccgccacccagcgcgccgaccacccggagaccaccgcgctggccgccgccgtgggc
gcgctgttcgtccggggcacgaccccggactgggccgcgctgttcgccggttccggcgcc
cgaccggtcgacctgcccacctacccgttccagcgccgccgctactggctcgacgccgcc
gtcggcggcacgggctcgggcagcggccacccgctggccggggacgtgctcaccaccgcc
gagggcgacggcgtcctgctcaccggccggatctcgccgcgcacccacgcgtggctggcc
gaccacaccgtctcgggcgaggtcctgctgcccggcacggcgttcgtggagctggccgtc
caggcgggcgaccaggtcggctgcggccgggtcgaggagctgaccctccagtccccgctc
gtgctcccggagcgcggcggcgtcgtgctccaggtcgccgtgggcggcccggacgagtcc
ggccgccgcacggtcaccgcgcactcccggcccgacgccgagggcgcgcagtggaccagg
cacgccaccggctcgctcgtcccggacaccgaggtcgccacgaccgacgccgacctgacc
ggcgagcccggccggtgggcgcccccggacgccaccgagctggacctcaccgggcactac
gcggagctggccgcccgcggctacggctacggcccggcgttccagggcctgcgcgcggcc
tggcggcgcggtgacgaggtgttcgccgaggtcgccctgcccgaggaggtcgacgcctcc
ggctacggcctgcacccggcgctgctcgacgccaccctgcacaccgccgagctgctggag
gacgggcccggcgagctgaccgtcccgttcgcctggaaggacgtggtgctgcgggccacc
ggggcgtccgcgctgcgggtccgcctgacccgcaccggccccaccgcctactcggtcgcc
ctggccgacccggacggcgcgccggtcgccgaggtgggctcgctggcggtgcgcccactg
cccgccgccgagggcccctcggtcggcgacgcgctgttccggctcgactggaccccggtg
ctcggcgcggccgacaccccggccaggctcgccgtcctcggcgcgccgggccgcttcccg
gccgaggtcgcctacccggacctggacgcggtggcggcggcgggcccgcagggaccggac
tcggtcctgctgcccctgcccgccaccggcgacgacccggccgcggccggacgggcggcg
gtcgaggggctgctgccggtcctgcgccgctgggccgaggacgaccggctggcgggcaag
cggctcgtggtcgtcaccaccggcgcggtgtcggtggacggcgaggactcgcccggcctg
gcgcacgccgccctgtgggggctgctgcgctcggcgcaggtcgagcacccggacctggtg
ggcctggtcgacgtggacggcgaccccgcctccgacctggtcctgcccgccgccctgacc
gccggggagccgcagctcgcggtgcgcggcggccgggcgttcgcgcccaggctggtccgg
gccgggttgcccgcggcggcgcccgacttcggctccggccgggtcctggtcaccggcggc
ctgagcggcgtcggcgcgaccgtcgcccggcacctggtcaccgcgcgcggcgtcaccgac
ctgctgctcaccagccgtcgcggccaggacgcgcccggcgcggccgagctggtcgcggag
ctgaccggtctcggcgcctcggtcgaggtcgccgcgtgcgacgtcgccgaccgcgacgcc
gtcgccgccctgctggagggcctggagctctcggcggtcgtgcactcggcgggcgtcgtc
gacgacgcgctgctgtccgggctcacccccgagcaggtggcggcggtctggcggcccaag
gccgaggccgcctggcacctgcacgagctgacgcggggccacgacctgaccgcgttcgtg
ctgttctcctcgctggtctcggtggtcggcggagcgggccagtccgcctacgccgccgcc
aacggcttcctcgacgcgctcgccgcgcaccgccgcgcccagggcctgcccgccacctcg
gtggcgtggggcctgtggaccggggtgggcagcgcgatgaccggggagctgggggagcgg
gacctgcggcgcatggcgtcctccggggtgctgggcctgcggcccgccgaggggctggcg
ctgctcgacgcggcggtcgcctcggaccgggccgacctcgtggcggccaggctggacctg
gcggccgtgcggcaggcgtccggcgcggtgcccccggtgttccgggcgctggtgcgcggg
gcggtcaggcgggtcgccgggaccggcgcgcccacctcggggccgtcggtggccgagcag
gtcgccgcgctgccgcccgcccggcggcgcgaccacctcgtggagctggtgcgcggtctg
gtggcgggcgtcctcgggcacgacggcgcgcacgcggtcgacgcgggcaagggattcctg
gaactgggcttcgactcgctcgccgcggtcgagctgcgcaaccgggtggccgaggtggtc
ggggtgcggttgtccgcgacgctggtctacgaccacccgacgcccgccgccgtggccgag
ctgctgctgtccgaactgggcggggcggaggagtccgcgccctccttggaggccgagctc
gcccggttggagaccgcattggagaccgccgcgccggacgaggaggagcgcgtccgggtc
gagagcaggctgcgggcgctggtggcgcgctggtccggcgcaggtggggcggtggccgag
gcggccgacgtgctggacgcggtgaccgccgacgagctgttcgacatcctggacgaggag
ctcgaagcgaccgattga

DBGET integrated database retrieval system