KEGG   Actinosynnema pretiosum: CNX65_15995
Entry
CNX65_15995       CDS       T05092                                 

Definition
(GenBank) 2-amino-4,5-dihydroxy-6-one-heptanoic acid-7-phosphate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
apre  Actinosynnema pretiosum
Pathway
apre01100  Metabolic pathways
apre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apre00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    CNX65_15995
Enzymes [BR:apre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     CNX65_15995
SSDB
Motif
Pfam: DeoC Zeta_toxin
Other DBs
NCBI-ProteinID: ATE58198
UniProt: A0A290ZGQ5
LinkDB
Position
3718814..3719554
AA seq 246 aa
MHQHGGPRLLLVPLEQPAAGCGSLARTVAEVIDGGADAVVLHKGLLRHVHPESFTSASLV
VNLSASTKHAPDSTHLVAHVEEAVRLGADAVCVSVDFGSDGENRQIADLATVAEECDRWN
VPLLASVHPRGPEQGSPELLARAAGLAVDLGADLVELPPVADHAAQADVIAGCAIPVLVA
VTHHRVDAETVAEARRALAAGSGGITAGQAVADSGDPAALARVLANVVHADAPRGIPSAR
SRPHGV
NT seq 741 nt   +upstreamnt  +downstreamnt
atgcaccagcacggcggcccccgcctgctgctcgtccccctggagcagcccgccgcgggc
tgcggcagcctggcgcggaccgtcgccgaggtgatcgacggcggcgcggacgcggtggtg
ctgcacaaggggctgctgcggcacgtgcaccccgagtcgttcacctccgcctcgctggtg
gtgaacctcagcgccagcaccaagcacgcccccgactccacgcacctggtcgcgcacgtg
gaggaggcggtgcggctgggcgcggacgcggtgtgcgtgagcgtggacttcggctcggac
ggcgagaaccggcagatcgcggacctggccaccgtcgccgaggagtgcgaccggtggaac
gtgccgctgctggcctcggtgcacccgcgcggccccgagcagggctcgccggagctgctg
gcccgcgccgccgggctcgccgtcgacctcggcgccgacctggtggagctgcccccggtc
gccgaccacgcggcgcaggccgacgtgatcgccgggtgcgccatcccggtgctggtcgcg
gtcacccaccaccgggtggacgcggagaccgtcgccgaggcgcggcgcgcgctggccgcc
gggtccggtggcatcacggccgggcaggcggtcgcggactcgggcgacccggcggcgctg
gcgcgcgtgctggcgaacgtggtccacgccgacgccccgcgcggcatcccgtccgcccgc
agccgcccgcacggggtctga

DBGET integrated database retrieval system