KEGG   Actinosynnema pretiosum: CNX65_30940Help
Entry
CNX65_30940       CDS       T05092                                 

Gene name
sodN
Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
apre  Actinosynnema pretiosum
Brite
Enzymes [BR:apre01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CNX65_30940 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N Phage_clamp_A RNA_pol_I_A49
Motif
Other DBs
NCBI-ProteinID: ATE57166
UniProt: A0A290ZDT4
LinkDB All DBs
Position
7237885..7238301
Genome map
AA seq 138 aa AA seqDB search
MRLLSRIRELHRAIPEATAHCDLPCGVYDPAQARIEAESIKAVQEKYQANEDPEFRQRAV
LIKEQRSELVKHHLWVLWTDYFKAPHFEKYPQLHDLFNRATKAAGASGTKGNMDPATGQQ
LLDLIAEIDKIFWETKQA
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttctgtcgcgcatccgtgaactccaccgcgcgatcccggaggccaccgcgcac
tgcgacctcccgtgcggtgtctacgacccggcccaggccaggatcgaagcggagtccatc
aaggcggtccaggagaagtaccaggccaacgaggacccggagttccgccagcgcgccgtg
ctgatcaaggagcagcgcagcgaactggtgaagcaccacctgtgggtgctgtggaccgac
tacttcaaggcgccgcacttcgagaagtacccgcagctgcacgacctgttcaaccgcgcc
accaaggccgcgggcgcgtcgggcaccaagggcaacatggacccggcgacgggccagcag
ctgctggacctgatcgcggagatcgacaagatcttctgggagaccaagcaggcgtga

DBGET integrated database retrieval system