KEGG   Actinosynnema pretiosum: CNX65_31470Help
Entry
CNX65_31470       CDS       T05092                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
apre  Actinosynnema pretiosum
Pathway
apre00564  Glycerophospholipid metabolism
apre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CNX65_31470
Enzymes [BR:apre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CNX65_31470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA NAD_binding_8 Pyr_redox Thi4 HI0933_like 3HCDH_N AlaDh_PNT_C Lycopene_cycl GMC_oxred_N Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ATE57259
UniProt: A0A290ZE64
LinkDB All DBs
Position
7351908..7353647
Genome map
AA seq 579 aa AA seqDB search
MATRNPSRTSATGRLGPEDRERSWRRLGEETFDLVIVGGGVVGVGAALDAATRGLKVALV
EARDLASGTSSRSSKLFHGGLRYLEQLEFGLVREALRERELMLTKIAPHLVKPVSFLYPL
TNRVWERPYTAAGLLMYDTMGGARSVPGQKHLSRSGALRLAPSLKQDALIGGIRYFDAQA
DDARHTMMVGRTAAHYGAVVRSSTQVIDFLHESDRVSGVRVRDVEDGRETDVRAHAVINA
TGVWTDELQRLSGSRGRFRVRASKGVHIVVPRDRIVSETGLILRTEKSVLFVIPWRNHWI
IGTTDTDWNLDLSHPAATKADIDYLLAQVNSVLATPLAHEDIEGVYAGLRPLLAGESEST
SKLSREHAVARVAPGLVAIAGGKYTTYRVMGADAVNAASVDLPGRIQPSITDKVPLVGAD
GYHALVNQADHLAAEHGLHPYRVRHLLDRYGSLVHEVLALAADSPELLKPIPGSPDYLQV
EVVYAASHEGALHLEDVLTRRTRISIEYPHRGVESAEAVAGLMAGVLGWDEAAIAREVEV
YTARVEAERASQDEPSDQAADAVRAAAPEVRPELVEPVS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
gtggccacgcgcaacccgtcacgaacctccgcaacgggcaggctcggtcccgaggaccgg
gagcggtcgtggcgcaggctcggtgaggagaccttcgacctggtgatcgtcggcggcggc
gtggtcggcgtcggcgcggccctggacgccgccaccaggggcctgaaggtcgccctggtg
gaggcccgcgacctcgcgtcgggcacgtccagccggtcgagcaagctcttccacggtggc
ctgcgctacctggagcagttggagttcggcctggtcagggaggcgctgcgcgagcgggag
ctgatgctcaccaagatcgcgccgcacctggtcaagccggtgagcttcctgtacccgctg
acgaaccgggtgtgggagcggccgtacaccgccgccgggctgctgatgtacgacaccatg
ggcggcgcgcgctcggtgcccggccagaagcacctgagccgctcgggcgcgctgcggctg
gcgccctcgctcaagcaggacgcgctgatcggcggcatccgctacttcgacgcgcaggcc
gacgacgcgcggcacaccatgatggtcgggcgcaccgccgcccactacggcgcggtcgtg
cggtcgtcgacgcaggtcatcgacttcctgcacgagtcggaccgggtgtccggcgtgcgg
gtgcgcgacgtggaggacggccgggagaccgacgtccgggcgcacgcggtgatcaacgcg
accggcgtgtggaccgacgagctgcagcggctgtccggcagccggggccggttccgggtg
cgggccagcaagggcgtgcacatcgtggtgcccagggaccggatcgtgtccgagaccggg
ctgatcctgcgcaccgagaagtccgtgctgttcgtgatcccgtggcgcaaccactggatc
atcggcaccaccgacacggactggaacctggacctgtcgcacccggccgccaccaaggcc
gacatcgactacctgctcgcccaggtcaacagcgtgctggcgacgccgctggcgcacgag
gacatcgagggcgtgtacgcgggcctgcgaccgctgctggccggggagagcgagtccacg
tcgaagctgtcgcgcgagcacgcggtggcgcgggtcgcccccggcctggtcgcgatcgcg
ggcggcaagtacaccacctaccgggtgatgggcgcggacgcggtgaacgcggcgtcggtc
gacctgcccggccgcatccagccgtcgatcaccgacaaggtgccgctggtgggcgcggac
gggtaccacgcgctggtgaaccaggccgaccacttggcggccgagcacggcctgcacccg
taccgggtgcggcacctgctggaccggtacggctcgctggtgcacgaggtgctggcgctg
gcggcggactcgccggagctgctcaagccgatccccggctcgccggactacctccaggtc
gaggtggtgtacgcggcctcgcacgagggcgcgctgcacctggaggacgtgctgaccagg
cgcacccggatctcgatcgagtacccgcaccggggcgtcgagtcggccgaggccgtggcc
gggctgatggccggggtgctgggctgggacgaggccgcgatcgcgcgcgaggtcgaggtg
tacacggcgcgagtggaggccgagcgggcctcgcaggacgagccgagcgaccaggccgcc
gacgcggtgcgggcggcggcgccggaggtgcggccggagctggtcgagccggtgtcctga

DBGET integrated database retrieval system