KEGG   Actinosynnema pretiosum: CNX65_31790Help
Entry
CNX65_31790       CDS       T05092                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
apre  Actinosynnema pretiosum
Pathway
apre00020  Citrate cycle (TCA cycle)
apre00480  Glutathione metabolism
apre01100  Metabolic pathways
apre01110  Biosynthesis of secondary metabolites
apre01120  Microbial metabolism in diverse environments
apre01130  Biosynthesis of antibiotics
apre01200  Carbon metabolism
apre01210  2-Oxocarboxylic acid metabolism
apre01230  Biosynthesis of amino acids
Module
apre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apre_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:apre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNX65_31790
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CNX65_31790
Enzymes [BR:apre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CNX65_31790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ATE57323
UniProt: A0A290ZED0
LinkDB All DBs
Position
complement(7454650..7455870)
Genome map
AA seq 406 aa AA seqDB search
MGKIKVQGTVVELDGDEMTRIIWQFIKDKLVHPYLDVNLEYYDLGIEHRDATDDQVTIDA
ANAIKKHNVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFREPIIISNIPRL
VPGWTKPIIIGRHAHGDQYKATNFKVPGAGKLTVTFTPEDGSAPIEHVVANYGADGGVAM
GMYNFNKSIEDFARASFSYGLQRNYPVYMSTKNTILKAYDGAFKDIFQQVFEAEFKAEFD
AKGLTYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHFRQHQAGKPTSTNPIASIFAWTGGLKHRGKLDGTPEVTGFAETLE
KVIVETVESGKMTKDLALLVSRDQEWQTTEDFLATLDENLQKKMAG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaaggttcaggggactgtcgtcgagctcgacggcgacgagatgaccagg
atcatctggcagttcatcaaggacaagctggtccacccgtacctggacgtcaacctcgag
tactacgacctgggcatcgagcaccgggacgccaccgacgaccaggtcaccatcgacgcg
gccaacgcgatcaagaagcacaacgtgggcgtgaagtgcgccaccatcacgccggacgag
gcgcgggtggaggagttcggtctcaagaagatgtgggtctcgcccaacggcacgatccgc
aacatcctcggcggcgtcgtcttccgcgagccgatcatcatctcgaacatcccccggctc
gtccccggctggaccaagccgatcatcatcggccgccacgcccacggcgaccagtacaag
gccacgaacttcaaggtccccggcgcgggcaagctgaccgtgaccttcacgcccgaggac
ggctccgcgccgatcgagcacgtcgtcgccaactacggcgccgacggcggcgtggccatg
ggcatgtacaacttcaacaagtccatcgaggacttcgcgcgggcctcgttctcgtacggc
ctgcagcggaactacccggtgtacatgtcgaccaagaacaccatcctcaaggcgtacgac
ggcgccttcaaggacatcttccagcaggtgttcgaggccgagttcaaggccgagttcgac
gccaaggggctcacctacgagcaccgcctcatcgacgacatggtcgccgcggccatgaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggcgacgtgcagtccgacacg
gtcgcgcagggcttcgggtcgctcggcctgatgacctccgtgctgatgaccccggacggc
aagaccgtcgaggccgaggccgcgcacggcaccgtcacccggcacttccgccagcaccag
gcgggcaagccgacctccaccaacccgatcgcgtcgatcttcgcctggaccggtggcctc
aagcaccgcggcaagctcgacgggacccccgaggtcaccgggttcgcggagacgctggag
aaggtcatcgtcgagaccgtcgagagcggcaagatgacgaaggacctcgcgctgctggtc
agccgtgaccaggagtggcagaccacggaggacttcctcgccacgctggacgagaacctc
cagaagaagatggcgggctga

DBGET integrated database retrieval system