KEGG   Auxenochlorella protothecoides: F751_1217Help
Entry
F751_1217         CDS       T04132                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro03030  DNA replication
apro03410  Base excision repair
apro03420  Nucleotide excision repair
apro03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:apro00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    F751_1217
   03410 Base excision repair
    F751_1217
   03420 Nucleotide excision repair
    F751_1217
   03430 Mismatch repair
    F751_1217
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:apro03032]
    F751_1217
   03400 DNA repair and recombination proteins [BR:apro03400]
    F751_1217
Enzymes [BR:apro01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     F751_1217
    6.5.1.6  DNA ligase (ATP or NAD+)
     F751_1217
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     F751_1217
DNA replication proteins [BR:apro03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    F751_1217
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     F751_1217
DNA repair and recombination proteins [BR:apro03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     F751_1217
   NER (nucleotide excision repair)
    Other NER factors
     F751_1217
   MMR (mismatch excision repair)
    Other MMR factors
     F751_1217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 RMMBL
Motif
Other DBs
NCBI-GeneID: 23612608
NCBI-ProteinID: XP_011400407
UniProt: A0A087SNY6
LinkDB All DBs
Position
Unknown
AA seq 1248 aa AA seqDB search
MIHGVEVTLVDANHCPGAVQFLFQLQDGRKYIHCGDMRYAPHLKSDPHLQRFVGADAVFL
DTTYCNKRHTFPPQEESIAYVVAAVKRLLAGQAGEAEPDAPDGPEHADDSAAAPGADAPA
PKTPAGPRRVILISTYGIGKERILSAVAATTGLRLAVTEKKLAVMRCLNLPGLDVDGIFT
SDFSSTPLHVTPWGFIGESWPFFRPNWTNLEEYQRSQGVDEVVGFVPTGWTYDMARKVFP
VRRKGGCSIHLVPYSEHSSYLELLEYVEFLRPHQVIPTVGVEGESGEQAMRKMQAQFRHL
VDETKDKTTGGGETTHVAMDSDVTALPMLAVKPEPVADHQRPGASEPAPVSDAEAGVDEV
QAIIGTDVPASTILQLLNASRGDVQAAVNGYFDALSAPGLKREAHNVKHAPVALGASKSR
RPGKQGRRGGAPTSGTSKASAAGAAQQASITAFFGASPARAMPVLDLTEHAELEVKRPAS
LEAVEGADVKEPAPPQKRLILPSPTRGEPVPADSLPITLSEGHVNGDQDPAPVADAEPQA
APGAKAEESSKKAPDMARSVLSSARDAMAVLPENYDPKLHACWSAGEPTPYLHLARAFEA
AEATTKRLRVGDILTNMFRSVRVRPSGVVMALSPDDLVATAYLATGKVAPDYEGLELSVG
GGTVGAAIREAMGVSRQRLHQLYSQLGDLGDVAQSCRATQSMLRRPDPLTVPGVFRALHD
MAAHRGTGAGGRRQHAVLSLLRACREGEVRYVVRTLVQGLRVGASWRSVIPALARAVLMH
VEGTPRLPRVRLDAAAAAATAAFHVCPSLDLLCAAMRSHPVEELERHVGLVAGVPIKPML
AKISEGVADAIAQLKGAPFLAELKYDGMRSQIHVLLGGEVKVFSRNCEDRSSAFPDVGEL
MKEAVDVDALPLILDAEVVAVDRADGNRLRAFQELATRARVDVSAAAVQVDVAVFAFDCL
MAAGQSLMRSPLTERRKLLAQALSGAAPGRVELARCYEVAEGAGADPNADLPSTGTVVPA
TTAEEEHAAALQAALLEAFAQGGEGLMLKSLGAGYEPSKRADHWIKLKRDYCEGLHDTLD
LVVIGAWHGSGRKVGWCSPFLMAVWDPDTEQLQSLCRCMSGFSDAFYREATERLKATEIP
GPKAYYDTSESPDMWFEPREVWEIRGADLSLSPVSVVEELDDKDIEAASTAEDVAAMYNA
QSRKAKAGSTVAAQAATAASDDEEPHGKEALDDEVLEDKTHAEKALED
NT seq 3747 nt NT seq  +upstreamnt  +downstreamnt
atgatccatggcgtcgaggtcaccctcgtggatgccaatcactgccctggagctgttcag
ttccttttccaattacaggatggccgcaagtacatccattgtggagacatgcgctacgca
ccccacctcaagtctgatccccatctgcaacgttttgtgggggcggatgccgttttcctg
gacaccacctactgcaataaacggcacaccttccctccccaggaggaaagtatagcctat
gtagtggccgccgtgaagagattactggccgggcaggcgggggaggcggagcccgatgcg
ccagatggccccgagcacgcagacgacagtgcggcagcccctggcgccgatgcacctgct
ccaaagactcccgctgggcccaggcgcgtgatcctgatttccacgtatggcattggcaag
gagcggatcctgagtgcggtggcggctaccactgggcttcggctggccgtcactgagaag
aagctggctgtcatgcgttgcctgaaccttccaggcttggatgtcgacggcatcttcacc
tccgacttctcgtccacgccgctgcatgtgacgccctggggcttcatcggggagtcatgg
ccttttttccggccaaactggaccaacctggaggagtaccagaggagccaaggagtcgat
gaggtggttggttttgtgcccacagggtggacgtacgacatggcccgcaaggtatttcca
gtgaggcgcaagggcggctgcagcatccacctggtgccgtacagcgagcactcctcctac
ctggagctcctggagtatgtggagttcctgcgccctcatcaggtcattcccacagtgggc
gtggagggggagtccggcgagcaggccatgcgcaagatgcaggcgcagttcaggcacctg
gtggacgagaccaaggacaagacaactggcggcggggaaacaactcatgtggccatggac
agcgatgtcaccgccctgcccatgctggcggtcaagccagaacctgttgcagaccaccaa
aggcccggcgcatcggagcctgcccccgtgagtgatgccgaggctggagtggacgaggtg
caggcgatcattgggacagatgtgcctgccagcaccatcctgcagctgctgaatgccagc
aggggcgacgtgcaggcagcagtcaacggctactttgacgccctgagcgcccctgggctg
aagcgtgaggcgcacaatgtgaagcatgcaccggtggcgctgggagccagcaagagtcgc
aggcctggaaagcagggtcggaggggcggggcaccgacttctggcacgagcaaggcctcg
gcagcgggtgcagcgcagcaagcgagcatcaccgcgttcttcggcgcatcgccggccagg
gcgatgccggtcctggacctgaccgagcacgccgagctggaggtgaagcggccagcgagc
ctggaggcagtcgaaggagcggatgtcaaggaacctgctccaccccaaaagaggctgata
ctgccctctcctacccgcggcgagcctgtcccagcagacagcctgccaattactctgagc
gaagggcatgtcaatggcgaccaggaccctgcacctgtagctgacgctgagccccaggcc
gcccccggtgccaaggcagaggagtctagcaagaaggcaccagacatggcgcggtctgtt
ctcagctcagcgcgggacgcgatggcggtgctgcctgagaactacgaccccaagctccac
gcctgctggtctgcaggcgagcccacgccgtacctgcacctggcccgggcctttgaggca
gcagaggccaccaccaagcgcctgcgtgtcggcgacatcctcaccaacatgttcagaagc
gtgcgtgtgcggccgtcgggcgtggtgatggccctgtctcccgatgacctggtggccact
gcctaccttgccaccggcaaggtcgcccccgactacgagggcctggagctgagcgtcggc
ggcggcacggtgggcgccgccatccgggaggccatgggcgtttcgcgtcagcgcctgcac
cagctatacagccagctgggggaccttggcgacgtggcgcagtcctgccgcgcgacgcag
tccatgctgcgccgccccgacccgctcactgtgcccggcgtcttccgtgcgctgcacgac
atggccgcccaccgcggtacgggggcaggcggccggcgccagcacgccgtgctgagcctg
ctgcgcgcctgccgtgagggcgaggtgcgctacgtcgtgcgcacgctggtgcagggcttg
cgcgttggcgccagctggcgctctgtcatccccgccctggcgcgcgcggtgctgatgcac
gtcgagggcacgccgcggctgccgcgcgtgcggctggacgccgcggccgcggccgccact
gccgccttccacgtctgccccagcctggacctgctctgcgccgccatgcgcagccacccg
gtggaggagctggagcgccatgtgggcctggtggcgggcgtgcccatcaagcccatgctg
gccaagatctcggagggcgtggccgacgccatcgcccagctcaagggcgcaccattcctg
gccgagctcaagtacgacggcatgcgctcccagatccacgttttgcttggcggcgaggtc
aaggtgttctctcgcaactgcgaggaccgatccagcgccttcccggacgtcggcgagctg
atgaaggaagccgtagacgtggacgccctccccctcatcctggacgccgaggtcgtggcc
gtggaccgcgccgatggcaaccgactccgcgctttccaggagctggccacgcgcgcccgc
gtggacgtcagcgccgcggcagtgcaggtggacgtcgccgtgttcgcctttgactgcctg
atggcggcgggccagagcctgatgcggtccccactgaccgagcgacggaagctgctggca
caggcgctgagtggggcggcgccgggcagggtggagctggcgcggtgctatgaggtggct
gagggggccggggctgatcctaatgcagacctgcccagcaccggcactgtggtcccagcc
accaccgcggaggaggagcatgcggcggctctccaggccgcactgttagaggcctttgcg
cagggcggggagggcctgatgctgaagagtctgggggcggggtacgagcccagcaagcgt
gcggaccactggatcaagctgaagagggactactgcgagggcctgcacgacaccctggac
ctcgtcgtgatcggtgcatggcacggaagcgggcgcaaggtgggctggtgctcccccttc
ctcatggccgtctgggacccagacacggagcagctccagagcctgtgccgctgcatgagc
gggttctctgacgcattctaccgcgaggccacggagaggctgaaggccaccgagattcct
gggcccaaggcgtactatgacaccagcgagtcgccagacatgtggtttgagccacgcgag
gtctgggagatccgcggggcagacctcagcctgtcgccggtgagtgtcgtggaggagttg
gacgataaggacatagaggctgccagcacggccgaggatgtcgccgccatgtacaatgcg
cagtcccgcaaggccaaggcaggatcaacggtggctgcccaggccgcgaccgccgcctct
gatgacgaagagccccatgggaaggaggcgcttgatgatgaggtgcttgaggataaaacg
catgctgagaaagcgctcgaggactga

DBGET integrated database retrieval system