KEGG   Auxenochlorella protothecoides: F751_1347Help
Entry
F751_1347         CDS       T04132                                 

Definition
(RefSeq) Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro00020  Citrate cycle (TCA cycle)
apro00190  Oxidative phosphorylation
apro01100  Metabolic pathways
apro01110  Biosynthesis of secondary metabolites
apro01200  Carbon metabolism
Module
apro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
apro_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:apro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    F751_1347
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    F751_1347
Enzymes [BR:apro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     F751_1347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C FAD_binding_3 Pyr_redox_2 GIDA
Motif
Other DBs
NCBI-GeneID: 23612738
NCBI-ProteinID: XP_011396968
UniProt: A0A087SEC8
LinkDB All DBs
Position
Unknown
AA seq 621 aa AA seqDB search
MLPGRQAATVLGRLLGGTRSFSVGKTAYPIIDHTYDAIVVGAGGAGLRASVGLSELGFNT
ACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWLGDQDAIEYMCREAP
KAVIELENYGLPFSRTDEGKIYQRAFGGQSLDFGNGGQAYRCAAAADRTGHAMLHTLYGA
AMQHDVRFFVEYFALDLIMDADGACRGLLALCMEDGTLHRFRAHQTILATGGAGRSYFSC
TSAHTCTGDGGAMAARAGLPMQDMEFVQFHPTGIYGAGCLITEGSRGEGGVLRNAQGERF
MERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEADHIHLHLDHLPPELLAERLPGISET
AAIFAGVDVTREPIPVIPTVHYNMGGVPTNHHGEVVRPTAANPDAVVPGLMAAGEAASAS
VHGANRLGANSLLDIVVFGRACALRVGETVKPGQTHAPLPEGAGDEAIARLDRIRNAKGS
LPASSIRRTMQRVMQRDAAVFRTQSTLEEGCAAIDACVDSFADLGVKDRSMVWNTDMVEA
LELENCLINAAITMHSAEARKESRGAHSREDFKERDDKDWMKHTVAWFDWGKDKVRVDYR
PVHDQPLDDEMPHIPPKARVY
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccggcaggcaggctgccaccgtcctggggcgcctgctgggaggaacccgttcc
ttctccgttgggaaaactgcgtaccccatcattgatcacacctacgatgccatcgtggtc
ggagccggcggggcgggcctgcgggcttccgtgggcctgtcggagctcgggttcaacact
gcgtgtatcaccaagctgtttcccacccgctcccacacggttgcggctcaggggggcatc
aatgccgccctcgggaacatgactgaggacgactggcggtggcacgcgtacgacaccatc
aagggcagcgactggctgggcgaccaggacgcgatcgagtacatgtgtcgcgaggcgccc
aaggccgtcatcgagctggagaactacggcctgcccttctcccgcaccgacgagggcaag
atctaccagcgcgcgtttggcgggcagagcctggactttggcaacggcgggcaggcgtac
cgctgcgcggcggccgccgaccgcacggggcacgccatgctgcacacgctgtacggcgcg
gccatgcagcacgacgtccgcttcttcgtggagtactttgcgctggacctgatcatggac
gccgacggcgcctgccgcggcctgctggcgctgtgcatggaggacggcacgctgcaccgc
ttccgcgcgcaccagaccatcctggccacgggcggcgcggggcggtcctacttctcctgc
acctccgcgcacacctgcacgggcgacggcggcgccatggccgcgcgtgcgggcctgccc
atgcaggacatggagttcgtgcagttccaccccaccggcatctacggcgcggggtgcctc
atcaccgagggctcgcgcggcgagggcggcgtgctgcgcaacgcgcagggcgagcgcttc
atggagcgctacgcgccgacggccaaggacctggcctcgcgcgacgtcgtctcgcgctcc
atgaccatggagatccgggaggggcgcggcgtggggcccgaggccgaccacatccacctg
cacctggaccacctgccccccgagctgctggcggagcgcctgccgggcatctcggagacg
gcggccatcttcgcgggcgtggacgtcacgcgcgagcccatccccgtcatccccaccgtg
cactacaacatgggcggcgtgcccaccaaccaccacggcgaggtggtgcgccccaccgcc
gccaaccccgacgccgtggtgccggggctcatggccgcgggggaggccgcctccgcctcg
gtgcacggcgccaaccgcctgggcgccaactccctgctggacatcgtggtgttcggccgc
gcctgcgcgctgcgcgtcggcgagacggtgaagccgggccagacccacgccccgctgccg
gagggcgccggcgacgaggccatcgctcgcctggataggatcaggaacgccaagggttcc
ctgcccgcgtccagcatccggcggaccatgcagcgcgtgatgcagcgcgacgcggcggtg
ttccgcacccagtcgacgctggaggagggctgcgcggccatcgacgcctgcgtcgactcc
tttgccgacctgggggtgaaggaccggagcatggtgtggaacaccgacatggtggaggcg
ctggagctggagaactgcctgatcaacgcggcaatcaccatgcactctgcggaggcgcgg
aaggagtcgcgcggcgcgcactcgcgcgaggacttcaaggagcgcgacgacaaggactgg
atgaagcacaccgtggcctggttcgactggggcaaggacaaggtgcgcgtggattacagg
cccgtgcacgaccagcccctggacgatgagatgccacacatcccgcccaaggcccgcgtc
tactga

DBGET integrated database retrieval system