KEGG   Auxenochlorella protothecoides: F751_1461Help
Entry
F751_1461         CDS       T04132                                 

Definition
(RefSeq) Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro00564  Glycerophospholipid metabolism
apro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    F751_1461
Enzymes [BR:apro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     F751_1461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 GIDA Pyr_redox_2 HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 23612852
NCBI-ProteinID: XP_011398743
UniProt: A0A087SJE3
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MRRLVLRSSLLAVGAGAGYALTGSSLADAKGVAPKLADRVPSREERLASLAKGTAENPFD
VLIIGGGATGTGCALDAVTRGLTTALVEREDFAAGTSSRSTKLVHGGVRYLEKAVKQFDY
GQYKLVHEALHERKTFLSNAPHLSHELPIMTPCYSWWEVPYYWAGMKLYDAVAGGKALSW
SYYLGPTKSRAQFPTMAGDRPDGKTLKGTIVYYDGQFNDARLAVSLAVTAALAGATVVNH
AEATSLIKAPDGRVTGAVVTDGLTGRATRVHARTVINATGPFADGLRRLSDPGTTPMIMP
SAGVHVTLPDYYSPENVGLIVPKTKDGRVVFMLPWLGHTIAGTTDADCAVTMRPQAREEE
VQFILDAIADYLTVKVRRSDVMSAWAGIRPLALDPNAADTASASRDHIVTVDPDGIITVT
GGKWTTYRLMAQDAIDRVLRERGAAAGPCVTAALPLVGGAGFYPGLFTEVAQTYKVPHRP
GAIDTKIAKYLVESYGDRAHEVTRIAEERRLGRRLVQGHPTLEAEVVYAVHNEFCETPED
FVARRTRFAFLDKRACEQALPRVVELMAKEKGWGRWKAAAELKRALEFIKTFDSPDHPAF
VPTA
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcctggtgctccgcagcagcctgctggccgtcggggcaggcgcggggtatgcc
ctgaccgggtcatccctggccgatgccaagggcgtggcgcccaagctggccgatcgggtg
cccagtcgtgaggagcggctggccagcctcgccaagggcaccgccgagaacccttttgat
gtcctgatcattggcgggggcgccaccggcaccggctgcgccctggatgccgtcacccga
ggcctgaccaccgccctggtggaaagggaggatttcgcagctgggaccagctcccggtcc
accaagctggtgcacggcggtgtgcgctacttggagaaggccgtgaagcagtttgattat
ggccagtacaagttggtgcacgaagctctgcatgagcgcaagaccttcctgagcaatgcg
ccgcacctgtcccacgagctgcccatcatgaccccctgctactcctggtgggaggtgccc
tactactgggcggggatgaagctgtacgatgcggtggcggggggcaaggccctgtcctgg
tcctactacctgggcccgaccaagtcgcgcgcccagttccccaccatggccggcgaccgc
cccgacggcaagacgctcaagggcaccatcgtgtactacgacggccagttcaacgacgcg
cggctggcggtgagcctggcggtgaccgccgcgctggcgggagccaccgtggtcaaccac
gcggaggccacctcgctgatcaaggcgcccgacggccgcgtgacgggggcggtggtgacc
gacgggctgacggggcgcgcgacgcgcgtgcacgcgcgcaccgtcatcaacgcgaccggc
ccctttgccgacgggctgcggcgcctgagcgacccgggcaccacgcccatgatcatgccc
tccgccggcgtgcacgtgacgctgcccgactactactcccccgagaacgtgggcctgatt
gtgcccaagaccaaggacggacgcgtggtgttcatgctgccctggctggggcacaccatc
gcgggcaccaccgacgccgactgcgcggtgaccatgcgcccccaggcgcgcgaggaggag
gtgcagttcatcctggacgccatcgccgactacctgacggtgaaggtgcgccgctccgac
gtcatgtcggcctgggccggcatccggccgctggcactggaccccaacgcggccgacacc
gcgtcggcctcccgcgaccacatcgtgacggtggaccccgacggcatcatcacggtgacg
ggcgggaagtggaccacctaccgcctcatggcccaggacgccatcgaccgcgtgctgcgc
gagcgcggcgcggccgcggggccctgcgtcaccgccgcgctgcccctggtgggcggcgcc
gggttctaccccgggctgttcactgaggtggcgcagacctacaaggtgccgcaccgcccg
ggcgccatcgacaccaagatcgccaagtacctggtggagtcctacggcgaccgcgcgcac
gaggtcacgcgcatcgccgaggagcggcggctcggccggcgcctggtccagggccacccc
acgctggaggcggaggtggtctacgccgtgcacaacgagttctgcgagacgcccgaggac
tttgtcgcgcgccgcacgcgcttcgccttcctggacaagcgcgcctgcgagcaggccctg
cccagggtggtggagctgatggcgaaggagaagggctggggcaggtggaaggccgccgcc
gagctcaagcgcgccctggagtttattaagacctttgactccccggaccaccccgccttc
gtgcccactgcttga

DBGET integrated database retrieval system