KEGG   Auxenochlorella protothecoides: F751_3969Help
Entry
F751_3969         CDS       T04132                                 

Definition
(RefSeq) putative alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro00052  Galactose metabolism
apro00500  Starch and sucrose metabolism
apro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    F751_3969
   00500 Starch and sucrose metabolism
    F751_3969
Enzymes [BR:apro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     F751_3969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 23615360
NCBI-ProteinID: XP_011398181
UniProt: A0A087SHT5
LinkDB All DBs
Position
Unknown
AA seq 1082 aa AA seqDB search
MATGLLVMLATSFLIPVAADQECDWTGPRVDCGYVGITEGECRNKGCCWNPADFQDFPYV
DVPWCFTQNAHPAEYEAAKIQEDNGGGSYAELALVKSVQPELGPDVTKLSASVRRVGCDT
LRLTLRDADEARWEVPTHLFKSDILAGSGPSMNGACGGSATTLEYNLLPHPFSLTVTRSG
DGASLFNSTGQRLVFKDQYLELSTVLSPGATLFGAGERVSRSLHLARNGAPRPLWNRDIG
PALEEQNSYGSHPWVLGLEPGTARGGFVFGGPTPLAVMEQFTAVIGRPALVPYWTLGWHQ
CKYGYASVWEVREVVANYSAAGLPLEAQWIDIDQMDHWMDFTFDPVDFPVEEMQALVEDL
HANGQKFVPILDPGIKVEPGYHAYDEALKRDLFVRNVEGDPYLGWVWPGPCHFLDYLLPR
TAAYWEEELAAHHNILPWDGIWIDMNEISNFCTGDLCRLKPETESEVMSVLNSHHDGSSE
YNAHQLYSLAQTRVTAAAVESSYLGVGAYAAHWTGDNVATWDQLAKSIAGVLNIGLVGIA
MGGADICGFQGNTTSELCARWVSLGAFYPFARSHSDLHSTRQELYLWPEVAEAGRQALSQ
RYRLLPYLYSTMRAAHDTGAPAMRPLWMTFPEDVAGHRNDRQFMFGDALLVTPVLTQGAR
SVEGHFPPGTWYSLWNASDVVHARANGTDVTLDAPLERIPYHVRGGRIIGTAEPRRTTRD
TKAGALTLLVALPGEGSGAERSAHGVVYNDDGESARASPCSFLHANVTVRRDGQGSLSGT
LKIAFGSSWAWPGGARYPDDALGGAESVAADGDPPIPWPSLAGLRILGWEGGAPEAWHVP
AIRFIDLHIYLFVRSIDSEGSMDSCQDLFASKRLRRSGGILTQTDHDGFEQDEGSPRVFS
ATSSQSSLGAYMGCESTGDASGSTPYSEQYDEDRAGPQLLALVRRGEYSPSEVTPELLMT
MLWIMDSWHSQYKSRADVCLQIYLALHPAPQPMFHYFKAHMLAMQPGILQSCGWNARVDS
ELPACDDLLAQHPVHAAILNFVQDEVVRRCSGMCVAQNHDQIQQARFVAALPMAFDKVVS
VF
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atggccaccggcctactcgtcatgcttgcgacctcgttcctgatccctgtcgctgctgac
caggagtgtgattggactgggcctcgcgtggattgtggctatgtgggcattactgagggg
gaatgcaggaacaagggctgctgctggaatcctgccgacttccaggatttcccttatgtg
gatgtgccctggtgcttcacccaaaacgcccacccagcggaatatgaggctgccaagatc
caggaggacaatggcggcggctcctacgctgagctggcgctcgtcaagtcggtgcagcca
gagctgggcccagacgttaccaaactctccgccagcgtccggcgcgtcggctgcgacaca
ctacgcctgaccctccgcgacgctgacgaggcgcgctgggaggttcccacccacctcttc
aagtctgacatcctcgcagggtccggccccagcatgaatggagcctgcggagggtcagcc
actaccctggaatacaacctcctgccgcaccccttctccctgaccgtcacccgatccggg
gacggcgcctccctgttcaactccacgggccagcgcctggtgttcaaggaccagtacctg
gagctctccaccgtcctgtcgcccggcgccacgctgtttggcgcgggggagcgggtgtcg
cgctccctgcacctcgcccggaacggggccccgcgaccgctgtggaaccgcgacatcggg
cccgcgctggaggagcagaacagctacggcagccacccctgggtcctgggcctggagcca
ggcacggcgcgaggggggtttgtatttggagggcccacgcccctggccgtgatggagcag
ttcacggcggtcatcggccggccggccctggtgccctactggacgctgggctggcaccag
tgcaagtatggctacgcgtcggtgtgggaggtaagggaggtcgtggccaactactcagcc
gcaggactgcccctggaggcgcagtggatcgacatcgaccagatggaccactggatggat
ttcacctttgacccggtggacttccccgtggaggagatgcaggccctggtggaggatctg
cacgccaatggtcagaagtttgtgccaattctggatcctggcatcaaggtcgagccaggg
taccatgcctacgatgaggccctgaagcgagacctgtttgtgagaaatgtagagggcgac
ccctacctgggctgggtgtggcctggcccttgccacttcctggattacctcctccccagg
actgcagcgtactgggaggaggagctggcagcacaccacaacattctcccctgggatggg
atctggatcgacatgaacgagatctccaacttctgcactggcgacctctgccgcttgaag
cctgagactgagagcgaggtcatgtcggtgctcaacagccaccacgacggcagcagcgag
tacaacgcccaccagctctacagcctggcgcagacgcgcgtcaccgcggcggcggtggag
tcctcctacctgggggtgggggcttacgccgcacactggacaggcgacaacgtcgccacc
tgggaccagctggcaaagtccatcgccggtgtcctcaacatcggcctggttggcatcgcc
atggggggcgccgacatctgcggcttccaggggaacaccaccagcgagctctgtgcccgt
tgggtatcgctgggcgccttctacccctttgcgaggagccactcagacctgcactccacc
cgccaggagctgtatctgtggcccgaggtggcggaggcggggcgccaggcgctgagtcag
cggtaccgcctgctgccgtacctgtacagcacgatgcgcgccgcgcacgacaccggcgcg
ccggcgatgcgcccactgtggatgaccttccccgaggacgtggccggccaccgcaacgac
cgccagttcatgtttggggacgcgctgctcgtgaccccggtgctgacccagggcgcgcgc
agcgtggagggccacttcccacccggcacctggtacagcctgtggaacgccagcgacgtc
gtgcatgcgagggcgaacggcaccgacgtgaccctggacgccccgctggagcgcattccc
taccacgtgcgcggggggcgcatcatcggcacggcggagccccgccgcaccacccgcgac
accaaggccggggccctcaccctcctcgtcgcgctccctggggagggctctggcgctgag
cggagcgctcacggcgtggtgtacaacgacgacggagagagcgcccgcgcctcgccatgc
agcttcctccacgccaacgtcaccgtgcgtcgggatggccaaggatcgctgtccggtact
ctgaagatagcttttggatcgtcttgggcctggccgggcggtgcccggtaccccgacgac
gccctcggcggggccgagtctgtggccgcggatggcgaccctcccatcccatggccgtcc
ctggctggactcaggatcctgggctgggagggaggagctcccgaagcgtggcatgtacct
gccattcgcttcatcgacctccatatctacctctttgttcgcagtattgattcggagggg
tctatggactcctgccaagacctgttcgcctcgaaacgccttcgccggtccggcggcatc
ctcacccagaccgaccacgatggcttcgagcaggacgagggttccccgagggtcttctct
gccacctcctcccaatcctcgcttggcgcctacatgggctgtgagagcacaggggatgcc
agcggatcgaccccctactcggagcagtatgacgaggacagggcggggccgcagctcctg
gctctggtgcgacggggtgagtactcaccttcagaggtgacccccgagctgctcatgacg
atgctctggatcatggactcatggcactcacagtacaagtcgcgcgccgacgtctgcctg
caaatctacctggccctgcatcccgcaccacagcccatgttccactacttcaaggcccac
atgctggccatgcagcctgggattctgcaaagctgcggctggaatgcacgggtggacagc
gagctgcctgcctgcgacgatttgctggcacagcacccggtgcatgccgccatccttaac
tttgtacaggatgaggttgtcaggcgctgcagcggcatgtgcgttgcgcaaaaccacgat
cagatacagcaggcgcggtttgttgccgccctgcccatggcctttgacaaggttgtttct
gtgttttga

DBGET integrated database retrieval system