KEGG   Auxenochlorella protothecoides: F751_5321Help
Entry
F751_5321         CDS       T04132                                 

Definition
(RefSeq) Phosphoenolpyruvate carboxylase 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro00620  Pyruvate metabolism
apro00710  Carbon fixation in photosynthetic organisms
apro01100  Metabolic pathways
apro01200  Carbon metabolism
Module
apro_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:apro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    F751_5321
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    F751_5321
Enzymes [BR:apro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     F751_5321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase FRB_dom FTA4 MAP65_ASE1
Motif
Other DBs
NCBI-GeneID: 23616712
NCBI-ProteinID: XP_011401423
UniProt: A0A087SRQ4
LinkDB All DBs
Position
Unknown
AA seq 952 aa AA seqDB search
MSLLSTRRDGFATALSMSKDGPSAYALEVNQALLKEDDDLLRQTFLSVFRHHHPQLANKV
DVIFALSQAWCMSESDDDFDMLVKRLETLKPDEHILVASAFSQLLNLHNLTEEIVTARVE
KAARLGEVEQSTRSTNKSLERLVNELGQNPEDIFKALCRQRVDIVFTAHPTQAIRQSLLK
KYQKIRSEMDALHNTRMTPYERLECLDEIKSQIQAAWRTDEIRRKKPTPQDESRQGLSYF
HDTIFHGLPVFLRRIDTALKNIGQPMLPLDTKLFNFGAWMGGDRDGNPFVTAATTRDVVL
GARLSATMLLQSQISRLVYELSVWRASDELTAAAARILEARKDGLYAHTTRESYETEFGS
VREPFRVVLSEIRERLNSTSTTLRYLMSHPHLNVKETLDNDPGAYSDAEAIITPLMLCYD
SLVATGDSTIAFSELTDVIRQAQTFGLHLCQLDIRQESTKHAEAIDAITTYLGLGSFNAW
DEAQRTAFLLKELEERRPLLPADLPMSEEVADVIGTFKMLATLPSDSLGAYIISMAHTAS
DVLAVLLLQKECGIRETLRVVPLFETLDDLEYAETAMEQLFGNAWYHAHIAGAQECMIGY
SDSGKDAGRLAAAWGLYEVQERLAAVAAKYDVHLTLFHGRGGTVGRGGGPAHLAILSQPP
KTISGTLRVTVQGEVMEQQFGEKEIAFRTMDLYTSAVLEATLAPMEEPQAVWREAMREMS
RTSCEAYRAVVRHDPRFIEYFQTLTPVNELGRMNIGSRPAKRKAHGSIDTLRAIPWIFAW
TQIRFHLPVWLGMGQALRAMIDAGKLELLQDMYQNWMFFRVTLDMLEMVFAKADPRVVTM
YQRQLVDAGLHALGDELLRTFYEAEELVLKVMKHKGLLSSSSTAFLQQKLQLRAPYVAPL
NILQVYCLKTIRDIEAGKEVDESGYNPVPAAVALMSRDPEKTPFVGAVEDTL
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctcagcaccaggcgggacggcttcgccaccgccctgtccatgtccaaggac
ggcccctccgcctacgccctggaggtcaaccaggccctcctgaaggaggacgacgacctg
ctgcgccagaccttcctgtctgtcttccgccaccaccacccccagctggccaacaaggtg
gatgtcatctttgcgctctcccaggcgtggtgcatgtctgagagcgacgacgacttcgac
atgctggtcaagaggctggagaccctgaagcccgacgagcacatcctggtggccagcgcc
ttctcgcagctcctcaacctgcacaacctgaccgaggagatcgtgacggcgcgtgtggag
aaggcggcgcgcctgggcgaggtggagcagagcacgcggtccaccaacaagtcgctggag
cgccttgtgaacgagctcggacagaacccggaggacatcttcaaggcgctgtgccgccag
cgcgtggacatcgtgttcacggcccaccccacccaggccatccgccagtcgctgctgaag
aagtaccagaagatccggagcgagatggacgcactgcacaacacgcgcatgacgccctac
gagcggctggagtgcctggacgagatcaagtcccagatccaggccgcctggcgcaccgac
gagatccggcgcaagaagcccacgccccaggacgagtcgcgccaggggctgagctacttc
cacgacaccatcttccacggcctgcccgtgttcctgcgccgcatcgacaccgcactgaag
aacatcgggcagcccatgctgcccctggacacgaagctcttcaactttggcgcttggatg
ggcggtgaccgcgatggcaaccccttcgtcaccgccgccaccacacgcgacgtggtcctg
ggcgcgcgcctgtcggccaccatgctgctccagagccagatcagccggctggtatacgag
ttgtcagtctggcgtgccagcgacgagctgaccgccgctgccgcccggatcctggaggcg
cgcaaggatggcctgtacgcgcacaccacgcgcgagtcgtatgagactgagttcgggtcg
gtgcgcgaacccttccgcgtggtgctgtcggagatccgggagcgtctgaacagcaccagc
accacgctgcgctacctcatgtcgcacccgcacctgaacgtgaaggagacgctggacaac
gacccgggcgcgtactccgacgcggaggccatcatcacccccctcatgctctgctacgac
tcgctggtggccacgggggacagcaccattgccttcagcgagctgaccgacgtcatccgt
caggcccagacctttggcctgcacctctgccagctggacatccggcaggagagcacgaag
cacgccgaggccatcgacgccatcaccacctacctgggcctgggctccttcaatgcctgg
gacgaggcccagcgcaccgccttcttactgaaggagctggaggagcggaggccgctcctc
cccgccgacctgcccatgagcgaggaggtggccgacgtcatcggcaccttcaagatgctg
gccaccctgccctccgactccctgggcgcctacatcatctccatggcgcacaccgcctcc
gacgtcctggcggtgctcctcctccagaaggagtgcggcatccgggagacgctgcgcgtg
gtccccctgtttgagaccctggacgacctggagtacgccgagaccgccatggagcagctg
ttcggcaacgcctggtaccatgcacacatcgcgggcgcgcaggagtgcatgatcggctac
tccgactcgggcaaggacgcggggcgcctggccgccgcctggggcctgtacgaggtgcag
gagcgcctggcagccgtggccgccaagtatgacgtccacctcaccctcttccacggccgc
ggcgggaccgtgggacgcggcggcggccccgcccacctcgccatcctctcccagccgccc
aagaccatcagcggcaccctccgcgtcaccgtgcagggcgaggtgatggagcagcagttt
ggagaaaaggagattgccttccgcaccatggacctgtacacctcggcggtgctggaggca
acgctggcgcccatggaggagccgcaggcggtgtggcgcgaggcgatgcgcgagatgtcg
cgcacctcctgcgaggcctaccgcgcggtcgtccgccacgacccgcgcttcatcgagtac
ttccagaccctgacccctgtgaatgagctggggcgcatgaacatcgggtcgcgccccgcc
aagcgcaaggcccacggctccatcgacaccctgcgtgccatcccctggatctttgcctgg
acccagatccggttccacctccccgtctggctgggcatgggccaggccctgcgcgccatg
atcgacgcgggcaagctggagctgctccaggacatgtaccagaactggatgttcttccgc
gtcaccctggacatgctagagatggtgttcgccaaggccgacccccgcgtggtcaccatg
taccagcgccagctggtggacgccgggctgcacgccctgggcgacgagctcctccgcacc
ttctacgaggccgaggagctggtgctcaaggtgatgaagcacaagggcctgctgtccagc
tccagcaccgccttcctgcagcagaagctgcagctgcgcgcgccctacgtcgcgccgctg
aacatcctccaggtctactgcctgaagaccatccgcgacatcgaggcggggaaggaggtg
gatgagtcgggctacaaccccgtccccgccgccgtggcgctgatgagccgcgacccggag
aagacgcccttcgtgggcgccgtggaggacaccctgtga

DBGET integrated database retrieval system