KEGG   Auxenochlorella protothecoides: F751_6210Help
Entry
F751_6210         CDS       T04132                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
apro  Auxenochlorella protothecoides
Brite
KEGG Orthology (KO) [BR:apro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:apro01001]
    F751_6210
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:apro03019]
    F751_6210
   03036 Chromosome and associated proteins [BR:apro03036]
    F751_6210
Enzymes [BR:apro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     F751_6210
Protein kinases [BR:apro01001]
 Serine/threonine kinases: AGC group
  PKA family
   F751_6210
Messenger RNA biogenesis [BR:apro03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     F751_6210
Chromosome and associated proteins [BR:apro03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    F751_6210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr cNMP_binding Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 23617601
NCBI-ProteinID: XP_011398955
UniProt: A0A087SK05
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MSMSEGRAVVTPGESNDASLFVLESGICTMMGPSAEGSHRTCSAGSMFGDIRLSGMLSET
VLATVMAATPVKLWTIEHAMVVAVCRGVGRSLPGQQPAPAQTREGQAGEAGPLLGVREGR
DSPPLQGESVEQHAARKAAHAAGPMVKSVPVPLPSEPDLIRAKHALVQTLQDEPIALHEL
ERIAILGTGAFAYVVLVRCRGRVHALKVLSKSHVMAKGLQMHVLREKGIMSSLSSAFLVN
MAAALQDSQCLYMLLDFQQGGEFFTYLQNRTDPLSESSARFYAACVVAGLEYMHSKGVAW
RDLKPENLLLDGRGYLRLADFGFAKRIAPGSRSYTLCGTPEYLAPEILMQSGHGLPVDWW
ALGVLLYEMVAWTPPFHQEERAVMFRAICSANYTMPAYFSKDLKDLIRRLLNKQPSRRLG
TVQGGVSDIRKHPWFAGFDWSALVSQRMPAPFVPKVQGPEDMAHFEAGQEVAHKLLGSGR
HVSVGTFADF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgtctgaaggaagggcggtggtcacccccggggagagcaacgacgcctcactc
ttcgtgctggagtctggcatttgcaccatgatgggcccctctgcagagggctcccaccgc
acatgcagcgctggcagcatgtttggggacattcgcctgtctggcatgctcagtgagacg
gtgctggccactgtcatggcagcaacgcccgtgaagctgtggactatcgagcatgccatg
gtggttgccgtctgccggggagtggggcggagtctgccaggccagcagccagcccccgca
cagacgcgggagggccaggccggcgaagcagggcccctgctcggcgttcgcgagggcaga
gactcgcctcctcttcaaggggagtcagtcgagcagcatgcggccagaaaggccgcacac
gctgcagggcccatggtgaagtctgtgcccgtgccgctgccgtcggagccagacctcatc
cgtgccaagcatgctctggtgcagactctgcaggatgagcccatcgcgctgcatgagctg
gaaaggatcgcaattctgggcaccggagcctttgcctacgtcgtgctggtcaggtgcagg
ggccgggtgcatgccctgaaggtgctgtcgaagagccatgtgatggcaaagggactgcag
atgcatgtgctgcgcgagaagggaatcatgagctccctttcctcggctttcctggtcaac
atggcggcggccctgcaagacagccagtgcctgtacatgctcctggactttcagcagggc
ggagagtttttcacctatctccagaaccgcacagatccactctcagagtccagtgccagg
ttctatgcagcatgcgtggttgcaggactggagtacatgcattccaagggcgtggcctgg
agggatctcaagcccgagaacctcctgctggacggccgagggtacctgcgcctggccgac
tttgggtttgccaagcgaatcgcgccggggtcaaggagttataccctgtgtggcaccccc
gaataccttgccccggagatcctcatgcagtctggccacggtctgcctgtggactggtgg
gcgctgggagtcctcctctatgagatggtggcctggacccctcccttccaccaggaggag
agggcagtcatgttccgagccatctgcagcgccaactacaccatgcctgcctacttcagc
aaggacctcaaggacctcatcaggcgcttgctgaacaagcagcccagccgccgactgggc
acggtgcagggaggagtgagcgacatccggaagcatccctggtttgcagggttcgactgg
tcggccctcgtcagccagaggatgcctgcccctttcgtcccaaaggttcaaggcccagag
gacatggcgcactttgaggcagggcaggaggtggcacacaagctgctgggcagtggacgc
cacgtgtcggtgggcacctttgccgacttttga

DBGET integrated database retrieval system