KEGG   Auxenochlorella protothecoides: F751_6386Help
Entry
F751_6386         CDS       T04132                                 

Definition
(RefSeq) L-idonate 5-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
apro  Auxenochlorella protothecoides
Pathway
apro00040  Pentose and glucuronate interconversions
apro00051  Fructose and mannose metabolism
apro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    F751_6386
   00051 Fructose and mannose metabolism
    F751_6386
Enzymes [BR:apro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     F751_6386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Sacchrp_dh_NADP NAD_binding_3 Pyr_redox_2 2-Hacid_dh_C AroM Methyltransf_25 Glyco_tran_WecB
Motif
Other DBs
NCBI-GeneID: 23617777
NCBI-ProteinID: XP_011401663
UniProt: A0A087SSC3
LinkDB All DBs
Position
Unknown
AA seq 354 aa AA seqDB search
MATSLINHAVVLHGKDDLRYEEWPLSDEIGPGQVRIQIKAVGICGSDVHFWKHGRIAHFV
VEAPMVIGHESAGQVVGVGPGVTALHVGDRVALEPGIPCWEHRLSGSYNLDPDIKFFATP
PHHGSLCNFIDHPAYLCYKLPDNLDYEDGAMCEPLSVGIHACRRSGVSPGKRVLILGAGP
IGLVALLSASAFGADCVAITDLRQEALDLARELGARVTQRTLHDETPEEAARKLKESAAP
DGFDIVIDCAGFESTMQTALAAAAPGAKVVLVGMGQVEMKLPLGSASIREVDILGSFRYK
NTYDTCLSLLSSGRINVKPLITHRHDYTEKEVLQGFETASKPAETGAIKVMFSL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcaacatccctaatcaatcatgcggtggtcctgcatggaaaagatgaccttagatac
gaggagtggccactctcggacgagattggccctggacaagtcaggattcaaatcaaggcc
gtgggcatatgcgggagcgatgtccacttctggaagcatggcaggatcgctcactttgtg
gtagaggcgcccatggtgatcgggcacgagtcagcagggcaggtcgtgggcgtggggcct
ggagtaactgccctgcacgtcggggacagagtggctctcgagcccggcatcccctgctgg
gagcatcgactgagtgggtcgtataacctcgacccagacatcaagttctttgccacaccc
ccacaccatggctccctgtgcaatttcatcgaccatccagcctacctctgctacaagctg
cctgataacctcgactacgaggacggcgccatgtgtgagccgctcagcgtgggcatccat
gcatgcaggaggtctggcgtgtcccccggaaagcgggtcctaatcctgggagccggaccc
ataggcctcgtggcgctgctgtctgcctcggcctttggagcagactgcgtggccatcact
gaccttcgtcaggaggcactggacctcgcccgggagctgggagcccgcgtgacccagcgc
accctgcatgacgagacaccggaggaggctgcgcggaaactgaaggagagcgcagcccca
gacggcttcgacattgtcatcgactgcgcagggttcgagtctaccatgcagaccgcgctg
gcggccgccgccccaggggccaaggtggtcttggtgggcatgggccaggttgagatgaag
ctgcccctcggctcggcctcgatcagggaggtggacatcctgggatcgttccggtacaaa
aacacgtacgacacatgcctgagcctcctgtcgtctggccgtatcaatgtcaagcccctc
atcacccaccggcatgactacacggagaaggaggtgttgcaaggcttcgaaacggcttca
aagcctgcagaaacaggagccatcaaggtcatgttttctttgtaa

DBGET integrated database retrieval system