KEGG   Auxenochlorella protothecoides: F751_6488Help
Entry
F751_6488         CDS       T04132                                 

Definition
(RefSeq) Alpha-amylase type B isozyme
Organism
apro  Auxenochlorella protothecoides
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 23617879
NCBI-ProteinID: XP_011402018
UniProt: A0A087STB5
LinkDB All DBs
Position
Unknown
AA seq 484 aa AA seqDB search
MQTGHAPFTIGTLEEACRSAERSLVQYRFKPAKAQRELEGVSEAQHARLAGARSGSSPCS
TLWPRGEGLTSGAWDAAATSPPPAPEGSGREVLLQGFNWESWRHGWYDQLASRAGEIADT
GFTAVWLPPPTRSVSPQGYLPSDLYDLDSAYGSEAALRSCVAALHSHGLLALGDVVVNHR
CAERRGPCGRYNLFGGRLDWDAAAIVGDDAAYGGTGAPSSGAPFHAAPNIDHASPRVKAD
LCAWLAWLRSDVGLDGWRLDFVRGFAGAHVADYMRASGPRFAVGEFWDGLAYGPDGAPDH
DQDAHRGRLLAWLNAAGGRAAAFDVTTKGVLQAALERGEHWRLRDACGRAPGLVGLWPSR
AVTFVDNHDTGSSQGHWPFPAHAVAQGYAYCLTHPGTPCVFHDHFFAWGGGLRAAIRALL
AARRRARVHCRSALRVLEARAGLYAAEVDAALVCKLGPEDWQPPNVREWSLSCWGDQWAV
WERA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcagacagggcacgctccattcaccatcggcacgctggaggaggcctgccggtcggcg
gagcggtccctggtccagtacaggttcaagcccgccaaggcacagcgggagctggagggc
gtgagcgaggcgcagcacgccagactggccggcgcgcgcagcggctccagcccctgcagc
accctctggccccgcggcgaggggctgacctccggcgcctgggacgcggccgccacctcg
ccgcccccggcccctgagggcagcgggcgtgaggtcctgctccagggcttcaactgggag
tcctggcggcacggctggtacgaccagctggcgtcgcgcgcgggcgagatcgccgacacg
ggtttcaccgcggtctggctgcccccacccacccgctcggtcagcccccaaggctacctg
cccagcgacctgtacgacctggactccgcctacggcagcgaggccgcgctgcggtcctgc
gtggccgcgctgcactcccacggcctgctagcgctgggcgacgtggtggtgaaccaccgc
tgtgcagagcggcgcggtccctgcggccgctacaacctcttcggcggccggctggactgg
gacgctgcggccatcgtgggcgacgacgccgcctacggcggcaccggcgccccctcctcc
ggcgcccccttccacgccgcgcccaacatcgaccacgcctccccccgcgtcaaggccgac
ctctgcgcctggctggcctggctgcgctccgacgtcggcctggacggctggcgcctggac
tttgtccgcggcttcgccggcgcccacgtcgccgactacatgcgcgcctcgggcccgcgc
ttcgccgtcggcgagttctgggacgggctggcctacggccccgacggcgcgcccgaccac
gaccaggacgcgcaccgcgggcggctgctggcctggctgaacgcggcgggggggcgcgcc
gccgccttcgacgtcaccaccaagggcgtgctgcaggccgcgctggagcgcggcgagcac
tggcgcctgcgcgacgcctgcggccgcgccccggggctggtgggcctctggccctcgcgt
gccgtgaccttcgtggacaaccacgacaccgggtccagccaggggcactggcccttcccg
gcgcacgccgtcgcgcaggggtacgcctactgcctcacccacccgggcacgccctgcgtc
ttccacgaccacttcttcgcctggggcggcggcctgcgcgccgccatccgggcgctgctc
gccgcgcggcgccgcgcgcgcgtgcactgccgcagcgcgctgcgcgttctggaggcgcgc
gccggcctctacgcggccgaggtcgacgcggcgctggtctgcaagctggggccggaggac
tggcagccgccaaacgtgcgagagtggagcctgagctgctggggcgaccagtgggcggtc
tgggagcgcgcctga

DBGET integrated database retrieval system