KEGG   Acidihalobacter prosperus: BI364_00245Help
Entry
BI364_00245       CDS       T04495                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00620  Pyruvate metabolism
aprs01100  Metabolic pathways
aprs01120  Microbial metabolism in diverse environments
aprs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aprs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BI364_00245
Enzymes [BR:aprs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     BI364_00245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M AlaDh_PNT_C ThiF Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AOU96659
UniProt: A0A1D8IJJ8
LinkDB All DBs
Position
complement(51104..52342)
Genome map
AA seq 412 aa AA seqDB search
MSTDLKQAALDYHAQPKPGKIAIEITKPTETQRDLALAYTPGVAEPVRAIHQDPEAAYRY
TAKGNLVAVITNGTAVLGLGDVGALAGKPVMEGKVVLFKAFAGIDAFDIEVDTHDPDAFI
DTVALIAGGFGGINLEDIAAPHCFRIEKTLRERLDIPVFHDDQHGTAVIISAGLINAVKL
AGKHLEDARIVCLGAGAAGLAAMRLLVTLGARREHILMVDRQGVIRAGDESVNEYQRAFA
ANTDRRTLADACVDADVFVGVSGPNLLTAEMLASMAENPVVFALANPDPEIAPELAQQTR
QDVIMATGRTDYPNQINNVLGFPYIFRGALDVRARTINDAMLTAAVHALAALAHEPVPAA
VLKAYDLASLSFGRDYFIPKPFDPRLIDVVPAAISQAAIDSGVARITQVIRP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgacctgaagcaagccgcgctggattatcacgcccagccgaaacccggcaag
atcgccatcgagatcaccaagcccaccgagacgcagcgcgacctcgcactggcatatacc
cctggtgttgcggaacccgtgcgcgcgattcaccaagaccccgaggccgcctaccgctat
acggccaagggtaatctcgtcgccgtgatcaccaatggcaccgccgtactcggcttgggt
gatgtcggcgcacttgcgggcaaacccgtcatggagggcaaggtcgtgctgttcaaggcc
ttcgccggcatcgacgccttcgacatcgaagtggacacgcacgaccccgatgccttcatc
gataccgtcgccctcatcgcgggtggcttcggcggcatcaatctcgaagacatcgccgca
ccgcattgcttccgcatcgaaaaaaccctgcgtgaacgcctggacataccggtcttccac
gacgatcaacacggtaccgccgtgatcatctcggcgggactgatcaacgccgtgaagctc
gccggcaagcacttggaagacgcgcgcatcgtgtgcctgggtgctggcgccgccgggctc
gccgcgatgcgtctgttggtcacgctcggcgcccgtcgcgaacatattctgatggtggat
cgtcagggcgtaatccgcgccggcgacgaaagcgtcaacgaatatcagcgcgccttcgcg
gcaaacacggatcgacggaccctcgccgatgcctgcgtcgatgcagacgtcttcgtcggc
gtctctggccccaacttattgaccgccgagatgttggcctcgatggccgaaaatccggtg
gtattcgccctcgccaatcccgaccctgaaatcgctccggagctcgcgcagcaaacccgc
caggatgtcatcatggccaccggccgtaccgactacccgaaccagatcaacaacgtcctg
ggcttcccttacatcttccgtggcgctctggacgtccgcgcccgcaccatcaacgacgcc
atgctcaccgccgccgtacatgcactcgcggcgctcgcgcatgaacccgtgcccgctgcc
gtactcaaggcctacgacctagcctcgctgagcttcggccgggactatttcattcccaag
cccttcgacccgcgcttgatcgatgtcgtaccggccgcgatcagccaggccgcaatcgac
tccggcgtggcgcgcatcacgcaggtcattcgaccctga

DBGET integrated database retrieval system