KEGG   Acidihalobacter prosperus: BI364_00960Help
Entry
BI364_00960       CDS       T04495                                 

Definition
(GenBank) peptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00550  Peptidoglycan biosynthesis
aprs01100  Metabolic pathways
aprs01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:aprs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BI364_00960
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BI364_00960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aprs01003]
    BI364_00960
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aprs01011]
    BI364_00960
Enzymes [BR:aprs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BI364_00960
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BI364_00960
Glycosyltransferases [BR:aprs01003]
 Polysaccharide
  Bacterial polysaccharide
   BI364_00960
Peptidoglycan biosynthesis and degradation proteins [BR:aprs01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BI364_00960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AOU96769
UniProt: A0A1D8IJV9
LinkDB All DBs
Position
195971..198532
Genome map
AA seq 853 aa AA seqDB search
MRLIGRILRWLLVLAASGATIGVLAVAFAYLYFAPNLPDVAALRDVQYQVPLKVYSVDGR
LVAEYGEKRRDPLRFDQIPPTLVHAFLAAEDANFYEHPGISIRGLLRAAFELIKTGQKRQ
GGSTITMQLARNFFLSDRKTYSRKIRELFLALKIEKALSKDQILELYLNKIYLGNRAYGV
GAAAHVYYGENVQKLTVAQMAMIAGLPKAPSAYNPLADPSRALERRGYVLTRMHDLGFIT
ATQFEQAMQAPITASLHGTDIEAHAPYLAEMVRQDMYSRYGDRAYTDGFKVYTTIKAQDQ
ADATSALHEDLIAYTERHGYRGPEVKTRLSGDLLKQWRAGLTHMPAAGGSAEGAVIPMWD
QLLSHYGPVGGLQAGLVAASDAKMAEVYLAGGQVVALGVDDMAWAGRYISVNRVGPAPTS
ADALLKPGDVIRVRDVRGHWSLSQVPKVSGALVALNPHNGAIVALVGGFDYYASKFNRVT
QALRQPGSSFKPFVYSAALHDGYTPATLVNDAPVVVRDSALEGVWRPENYERNFNGPTRL
RLGLVHSLNLVSIRVLQAIGIDYALKYAARFGFDPARLPHNLTLALGSASVTPLEMATGY
AVFANGGYRVAPFYIDRIVGGDGSVLYQAHPATVCEPNCPAAQATATPSVPSQVLPENTT
GPAVATPLASARPLSLDTTETAPAIRPAVRVIGAGNAYQMTSMMKDVIRMGTGRAALRLQ
RTDLAGKTGTTNDQVDAWFSGFNSDLVTTAWVGFDDNQPLGHAETGARAALPMWMDFMGA
ALKGLPEATMPQPQGIVTVKIDPKTGLLANPGEADAIFETFREGHLPKPDTSAAVSGSEA
TPQGSRGLTQQLY
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgagactcatcggcaggattctgcgctggctgttggtattggccgcaagcggcgcgacc
atcggggtactggcggtcgccttcgcctatctttacttcgcgccgaatctgcccgatgtc
gcggcgctgcgcgacgttcagtaccaagtgccgctgaaggtatatagcgtagatggccgg
ctcgtggctgaatatggggagaagcgccgcgatcccctgcgtttcgatcagataccgccg
acactggtccacgccttccttgcggccgaggatgccaacttttacgagcatccaggcatc
agtatccgagggctgttgcgcgcggcattcgagctgatcaagaccggtcagaagcgccaa
ggcggcagtaccatcacgatgcagctggcgcgcaacttcttcctgtccgatcgcaagacc
tactcgcgcaagattcgcgaactgttcttggcactcaagatcgaaaaggccttgagcaaa
gaccagatcctcgagttgtacctgaacaaaatctatcttggtaatcgcgcttacggagtt
ggggccgccgcgcacgtctactacggtgaaaatgtccaaaagctcactgtggcgcagatg
gcgatgatcgctggattgcccaaggctccctcggcctacaatccgcttgcagatcccagc
cgagcattggagcgtcggggttacgtgttgacccggatgcacgatcttgggttcatcacc
gcaacccagttcgagcaggccatgcaagccccgatcacggcgagtttgcatggcacggat
atcgaggcgcatgcgccctatctggcggagatggtgcgtcaggacatgtacagccgttac
ggagaccgcgcctataccgatggcttcaaggtctataccactatcaaggcgcaggaccag
gcggacgcgactagcgccctgcacgaggatctgattgcatatacagagcgtcatggctac
cgaggcccggaggtcaaaacccgcttgagtggcgacctcttgaagcagtggcgcgcgggt
ctgacgcacatgcccgctgcaggtgggtctgccgagggcgcggttattcctatgtgggac
caattactgagccattatggcccggtgggtgggttacaggccggcctggtggccgcatcc
gatgccaagatggcggaggtttacctggcgggtgggcaggtggtcgcgctgggggtggat
gacatggcatgggcggggcggtacataagtgtcaaccgcgtcgggccggccccgaccagc
gcggatgcgctgctcaagcctggtgacgtgattcgcgtgcgtgacgtgcgtgggcattgg
tcgctttctcaggtgcccaaggtgtcgggcgctctggttgcgctcaatccgcacaatggg
gcgatcgttgcactggtcggtggcttcgattattacgccagcaagttcaatcgggttaca
caggcgctccggcagccgggttcgagtttcaagccatttgtttactccgcggcattgcat
gatggctatacgccagccaccttggtgaacgacgcccctgtcgtggtcagggattctgcg
ttggaaggcgtgtggcgaccagagaactacgagcgcaatttcaatggccctacccgcttg
aggttggggctggtgcactccctgaatcttgtttcgatacgggtgctgcaagcgatcggc
atcgactacgcgctcaaatatgccgcgcggtttggtttcgatcctgcgcgcttgccacac
aacctcacgttggcattgggcagcgccagcgtgacgcccttggagatggcaacgggttac
gcggtatttgcgaatggcggttatcgggtcgcgccgttctacatagaccgtatcgttggt
ggggatggcagcgttttgtatcaggctcatccggctacggtttgtgagcccaattgtccg
gccgcgcaggcaacggcaactccaagtgtgccttcgcaagtgctgcctgagaacactacg
gggccggctgtcgcgacaccgctggcatccgcccgccccctgagcctcgatacgacggag
acggcacctgcgatcaggccggcggttcgggtgattggtgccggtaacgcttatcaaatg
accagcatgatgaaggatgtcattcggatgggaaccggtcgcgctgccctgcgtctgcag
cgcaccgatctggcgggtaaaaccggcacgacgaacgaccaagtggacgcctggttcagt
ggcttcaattcagatctggtaaccaccgcctgggtggggttcgacgacaatcagccattg
gggcatgcggagactggtgcacgcgccgcattgcccatgtggatggatttcatgggcgcc
gcgctcaagggtttgcccgaagcgactatgccgcagcctcagggtatcgtgacggttaaa
atagatcctaagaccggcttgctggccaatccgggagaggctgatgcgatctttgagaca
ttccgtgaagggcatctgccgaaacccgatacgtcggcagcggtttcaggctccgaggcg
acaccccagggtagccgcggcttgacccagcaactctattga

DBGET integrated database retrieval system