KEGG   Acidihalobacter prosperus: BI364_01510Help
Entry
BI364_01510       CDS       T04495                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00630  Glyoxylate and dicarboxylate metabolism
aprs01100  Metabolic pathways
aprs01120  Microbial metabolism in diverse environments
aprs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aprs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BI364_01510
Enzymes [BR:aprs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BI364_01510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AOU96858
UniProt: A0A1D8IK72
LinkDB All DBs
Position
310442..310768
Genome map
AA seq 108 aa AA seqDB search
MAVNPYISSKRYETFSYLPAFTPEQVRNQIAYAISQGWNPAVEYAHPDDQADHYWHMWGL
PMFGEDAVDVVLSEIAACHRAFPNYVVRFVAYDNYTQSQGLAFVVHRG
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgaacccttatatttcaagcaagcgttatgagacgttctcctacctgccggcg
tttacgcccgagcaggtgcgcaaccagatcgcctatgccatttcccagggctggaacccg
gcggtggagtacgcccatccagacgatcaggccgaccactactggcacatgtggggcctg
ccgatgttcggcgaggatgcggtcgacgtggtgctcagcgagatcgcagcttgtcatcgt
gccttcccgaactatgtcgtgcggtttgtggcgtatgacaactatacccagagccagggt
ttggctttcgtggtccatcgcggatag

DBGET integrated database retrieval system