KEGG   Acidihalobacter prosperus: BI364_02200Help
Entry
BI364_02200       CDS       T04495                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00061  Fatty acid biosynthesis
aprs01100  Metabolic pathways
aprs01212  Fatty acid metabolism
Module
aprs_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aprs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BI364_02200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aprs01004]
    BI364_02200
Enzymes [BR:aprs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BI364_02200
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     BI364_02200
Lipid biosynthesis proteins [BR:aprs01004]
 Fatty acid synthase
  Component type
   BI364_02200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AOU96976
UniProt: A0A1D8IKI3
LinkDB All DBs
Position
complement(441777..442268)
Genome map
AA seq 163 aa AA seqDB search
MHFTKAQILTMAEGGFFGEGNAQLPSAHMLMIDQIHCISSTGGRYDKGHLEASLDIHPTH
WFFACHFKDDPVMPGCLGLDALWQLLGVFLGWSGLPGKGRALGVGQVKFSGQIHPDAGSI
QYRLDIKRVFSGQLSVGVADGQVIHKGETIYRAEGLKVGLITQ
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcacgaaagcgcaaattctgaccatggcggagggtggtttttttggtgagggt
aatgcacaactacccagcgcccatatgctgatgatcgaccagatccattgcatatcttct
accggcggccgctacgacaaaggacacttggaagccagtctggatatccacccaacccac
tggtttttcgcctgccatttcaaagatgatccggtaatgccgggttgcttgggattggat
gccctgtggcaattattgggagtcttcctcggctggtcaggcctaccgggcaaagggcga
gcacttggcgtcggccaagtaaagttcagtgggcaaatccatccggatgccggatcgatt
cagtatcgtctcgacatcaaacgggtattttcagggcaactgtcggtaggcgtcgccgac
ggccaagtcatccacaagggtgaaacaatctatcgggcagagggcctgaaagtggggctc
atcacgcaatag

DBGET integrated database retrieval system