KEGG   Acidihalobacter prosperus: BI364_02795Help
Entry
BI364_02795       CDS       T04495                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aprs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BI364_02795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aprs02000]
    BI364_02795
Enzymes [BR:aprs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BI364_02795
Transporters [BR:aprs02000]
 Other Transporters
  Pores ion channels [TC:1]
   BI364_02795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C
Motif
Other DBs
NCBI-ProteinID: AOU97072
UniProt: A0A1D8IKS9
LinkDB All DBs
Position
complement(569242..569889)
Genome map
AA seq 215 aa AA seqDB search
MNSPSELTFFHAPHSRSSSVRVLLEELGAPYRIHAINLKDEAEYDPSYRAINPLAKVPAL
KDGDAVITERVAIHIYLPDRFPAGGLAPTVDDPQRGPYLRWLALYGSCFEPAVIDRQQQH
APAPYSTSPYGDFDTLFKTLTDHLEHQGPWMLGERFSSADILWASSLNFTTHFELIPEHP
AIRAYIDRYLARPAVQRTYAADIELAETQDAGVTT
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcccatccgaattgaccttcttccacgcgccgcacagccgctcctcgtccgtt
cgcgtactgcttgaagagctgggtgcgccctatcgaatacacgccatcaatctcaaggac
gaggccgaatacgaccccagctatcgcgccatcaaccccttggccaaggtgccggccctg
aaggacggtgacgctgtgatcacggaacgcgtcgccatacacatttacttgcctgaccgt
ttcccagcgggcggactcgcacccaccgtcgacgatccgcaacgcggtccctatctgcgc
tggctggcgctctacggctcctgcttcgaacccgcggtcatcgatcgccagcagcagcac
gcacccgcaccctactcgacttcaccctatggcgatttcgataccttgttcaaaacactc
accgatcatctcgaacaccaaggcccttggatgctgggcgaacgtttcagctcggccgat
atactctgggcttcctcgctcaactttacgacacactttgaactcataccggagcacccg
gcgatccgcgcctatatcgaccgctatcttgcccgccctgccgtgcaacgcacctatgcc
gccgatatcgaactcgccgagacgcaggatgccggggtcacaacttga

DBGET integrated database retrieval system