KEGG   Acidihalobacter prosperus: BI364_07990Help
Entry
BI364_07990       CDS       T04495                                 

Definition
(GenBank) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00500  Starch and sucrose metabolism
aprs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aprs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BI364_07990
Enzymes [BR:aprs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BI364_07990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AOU97912
UniProt: A0A1D8IN68
LinkDB All DBs
Position
complement(1674818..1677271)
Genome map
AA seq 817 aa AA seqDB search
MSEPPGGPGIPATWSASRKDMIGCALGSPRLWYTLGQGIVNEVYYPRVDIPQIRDLGFMI
ADDEGFWVEIKQHDNYEIASCGAGAPVVTLIHRHPRFTLRIGVCPDPRRDVLMLEVALEG
DPGLRPYVLLAPRLGGSDNHNEAWYDEYHGRRVLWANQGPFALALVARDERGNDAFVRGA
VGYVGENDGWQDFSRHGSMRWAYTHAGPGNVALTGELPRHAVLALGFGSGRRSAATLAFA
SLSHSYARVVEHCCAQWDAWHQVWEAQFPEVNTLEPELFNLLRTSAMVVKVHEDKTYPGA
VVASLSIPWGETREREGGYHLVWPRDLVETAGALLTLGAHEDARANLRYLIANQHADGHW
NQNQWLGGRAYWQGLQLDETAFPILLAGALDEHEALGDIRPQDMIRRALGFIALNGPVSD
QDRWEEDCGLSPFTLAVMVASLVVGAEYLPPAERDLALTLADSWNAQIEDWTVAHDSELG
RNHGIAAHYVRVGPRGVLQHREAMREAIIVNNRDPQPTLTADGHVSLDFLQLVRYGLRRA
DDPLIRDSLQLADRLLRIETPQGPAWYRYNEDGYGEHADGSPFDGTGKGRPWPLLAGERG
HYELANGGDPSALLHTMAASASPGGMLPEQIWDDTARPDWGLVPYRPTGSAMPLAWAHAE
FIKLAAARARGRPVDRPGPVWARYQGVRAHSDIRFWTLSAPIGRIPPGCRLKLLLSHDTT
LIWSHHDWAHAHHSPVGKPLLDLPYRSRLDVTARGNLALLPALDRWLPEYTGIPYRVHLR
LRSPQSQCSEEKLLWPHPTITCAGICDSCCHSPYCMP
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccccccggtgggcccggtatcccggccacctggagtgcaagccgcaaggat
atgatcggttgcgcgctgggttctcctcgactctggtatacgctgggtcagggcatcgtc
aacgaagtctattatcctcgcgtcgacattccacaaatccgcgatctcggcttcatgatt
gccgacgacgaaggtttctgggtcgaaattaagcagcatgacaactacgagatcgcgtct
tgtggcgcaggcgcacccgtcgtcaccctgattcaccgccacccgcgattcacgctgcga
atcggcgtctgccctgaccctcgtcgagacgtattgatgcttgaagtcgccctcgaaggc
gaccctggattacggccttacgtactgctcgcccccagattgggcggtagtgataaccat
aacgaggcttggtatgacgaatatcatgggcgtcgcgtcctgtgggccaatcagggccct
ttcgccctcgctctggttgctcgcgacgaacgaggcaacgatgccttcgtacgcggcgcc
gtcggctacgtcggcgagaacgacgggtggcaggatttctctcgccatgggtctatgcgt
tgggcatatacgcatgccggtcccggcaatgtcgccctcactggtgaacttcccagacac
gcggtgctcgcgttgggctttggcagcggacgacgctccgccgccacgctcgccttcgcc
agcctgagccattcgtatgcgcgtgtagtcgagcactgctgcgctcaatgggatgcctgg
catcaggtctgggaagctcaattccccgaagtcaacaccttggagccagaattattcaat
ctgctacgcacctccgctatggtcgtcaaggtgcacgaagacaagacctatccaggtgca
gtggtggccagcttgagtatcccctggggagagacgagagaacgcgagggtggctaccat
ctggtttggccacgagatctcgttgaaacggcaggagcgctgctcacacttggcgcgcat
gaggatgcccgcgccaacctgcgctatctgatcgccaaccagcatgccgatggacactgg
aatcagaatcaatggctcggcggtcgagcctactggcaggggcttcaactcgacgaaacc
gcctttccgatcttgctcgctggcgctctcgacgaacacgaggctctcggcgatattcga
ccgcaggatatgattcggcgcgcgctcggttttatcgccctcaacggccccgtcagcgat
caggatcgctgggaggaagactgcggcctaagccctttcacactggcggtaatggtcgca
agtctggtggtcggtgccgaatacctgcctccggcggaacgcgatctggcgctcacgcta
gccgacagctggaatgcccaaatcgaggattggactgtcgcccatgacagcgagctcggc
agaaaccatggcattgccgcgcactatgttcgcgtcgggcctcgcggggtcttacaacat
cgcgaagcgatgcgtgaggcgattatcgtgaataatcgtgacccccagcccaccctcacg
gcagatggacacgtcagtctcgattttctgcaattggtgcgttacggactgcgccgcgcc
gacgatccgctaatacgagacagtctgcaattggccgaccggctattgcgcatcgaaacg
ccccagggtccagcctggtatcgttacaacgaggatggatatggcgaacacgccgacggc
agtccgttcgacggcacgggtaaggggcggccttggccgctactcgccggcgaacgcggc
cattacgaactcgccaacggcggggatccgtcagcgcttctgcacaccatggccgcgagt
gcgagccccggaggaatgctacccgagcaaatatgggacgataccgcccgccctgattgg
ggactcgtaccctatcgacccacgggttcggccatgccgctcgcctgggcgcacgccgaa
ttcatcaagctcgccgccgcgcgcgcgcgggggcgcccggtagatcgccccggaccggtc
tgggcgcggtatcagggggtgcgagcgcattcagatatccgtttctggacgctatcggca
cccatcggacgaatcccccctggttgtcggctgaagctactgttatcgcatgacaccacc
ttgatctggagccatcacgattgggcgcacgcgcatcactcgcctgtcggcaagccttta
ctcgacctaccctatcgatccagactggacgtcacggccaggggaaaccttgcgcttcta
cctgcgctggaccgatggctccccgaatacaccggaataccgtatcgtgtgcatctgcga
ttaaggtcgccgcaatcccaatgttccgaggagaaactgctttggccccatcccaccatc
acctgcgcaggtatctgcgattcctgttgccactcaccctattgcatgccgtag

DBGET integrated database retrieval system