KEGG   Acidihalobacter prosperus: BI364_10580Help
Entry
BI364_10580       CDS       T04495                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:aprs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BI364_10580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aprs01002]
    BI364_10580
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aprs01011]
    BI364_10580
Enzymes [BR:aprs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BI364_10580
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BI364_10580
Peptidases and inhibitors [BR:aprs01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   BI364_10580
Peptidoglycan biosynthesis and degradation proteins [BR:aprs01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BI364_10580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AOU98350
UniProt: A0A1D8IPB8
LinkDB All DBs
Position
complement(2207831..2209402)
Genome map
AA seq 523 aa AA seqDB search
MIHRRRPAVFPPLASTRRGGVLTGWLFALCFALSAAAAHATDKAVEAPPYSLPALNHLVA
SGARVSARVIDIESGRTLATLDPGQALIPASVTKLYTSAAALDRWGAAKRFTTRVTRLGS
VKQGVLHGDLVFVGGGDPGLVNAQLWTLAQRVRESGIRVVDGRLLVDARRFGPVPCVTRD
RCRAKRESEDAYNAPLSSAGVDFSNACLSVRPGAQAGAPARLAFEPFDLPMLAIRGRVET
LPPGQPAHIRVVRRSEGAREVFEVSGGIPLGGKPRRFYRSIAHPDRFAGEVFRAFLEQAG
VAVHGGVAVVRAGGKVMAGVPVAKVEGTPLGEQLRGMLVYSNNYMADTLALDWAAADGAP
VPVNLPEAGRRLSAYARAVDVASLFAWARDGRPLLESGSGLTVGNRLSANDITALLAHEY
HRYGDFPAFLAGLTVPDQTPVAMLKGGSTAWDTRIAAKTGSLNQPVSVFALAGYLRLAHG
RWGAFAVLVNGGHRRPHVGLFDAIAAVRSDLEALLARDDAAHP
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtgatacatcgccgccgccccgctgtcttcccgccgctggcctcgacccgacggggcggt
gtgctgacgggttggctcttcgccctgtgtttcgccttgtccgccgccgcggcccacgcg
acggacaaggccgtggaagcgcccccttattcgctgcccgcgctcaaccatctggtggcg
tctggcgcgcgggtcagcgcgcgggtgatcgacatcgagagcggccgtacgctggccacc
ttggatccggggcaggcgttgatcccggcctcggtgacgaagctgtacacgtcggccgcc
gcgctcgatcgctggggcgcggccaagcgattcacaacccgagttacccggcttgggtca
gtgaagcagggggtgctgcacggcgacctcgtgttcgtcggtggcggcgatccgggtttg
gtcaacgcgcagctctggacgctggcccagcgcgtgcgcgagtccggcatccgcgtcgtt
gacggtcgtttgctggtcgatgcgcgccgctttggcccggtgccctgtgtgacgcgcgat
cgctgccgggcgaagcgcgaaagcgaggacgcctataacgcaccgctgtcatcggccggg
gtggatttcagcaatgcctgtctgagcgtgcgtcctggcgcgcaggcgggggcacccgca
cgacttgccttcgagccgttcgatctgcccatgctggcgatccgcgggcgtgtcgaaact
ctgccgcccggccaaccggcgcatatccgcgtcgtacgccgcagcgagggtgcgcgcgag
gtcttcgaagtctccggtggcatcccgctgggcggcaagccccgccgcttctaccgctcg
attgcacaccctgaccgctttgccggagaggtattccgtgcgtttctcgagcaggccggg
gtggcggtgcatggcggggtggcggtcgtccgcgcgggcggcaaggttatggccggtgtg
cctgtcgctaaagttgagggtacaccgctaggcgagcagttacgcggcatgctggtgtac
agcaacaactacatggccgataccctggcactcgactgggccgcggccgacggtgcgccc
gtgcccgttaatctgccggaggcggggcgacgcttgagcgcttacgcccgagccgtcgat
gtcgcttcgctcttcgcctgggcgcgtgacggtcgaccgttgcttgaaagcggcagcggc
ctgaccgtgggcaatcgcttgtcggccaacgacatcacggcgctactcgcgcacgaatac
catcgttacggcgattttccggcctttctggcggggctgaccgtgccggaccagaccccg
gtggccatgcttaagggcggttcgacggcgtgggatacgcgcatcgcggccaagacgggt
tcgctgaatcagccggtgtcggtattcgcgctggcggggtatctccgcctggcgcacggt
cgttggggtgcattcgcggtgctcgtgaacggcgggcatcggcgcccgcacgttggtttg
ttcgacgccatcgctgcggtcagatcggacctagaggccctgctggcgcgcgacgatgcc
gcacatccttga

DBGET integrated database retrieval system