KEGG   Acidihalobacter prosperus: BI364_10675Help
Entry
BI364_10675       CDS       T04495                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00061  Fatty acid biosynthesis
aprs00780  Biotin metabolism
aprs01100  Metabolic pathways
aprs01212  Fatty acid metabolism
Module
aprs_M00083  Fatty acid biosynthesis, elongation
aprs_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:aprs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BI364_10675
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BI364_10675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aprs01004]
    BI364_10675
Enzymes [BR:aprs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BI364_10675
Lipid biosynthesis proteins [BR:aprs01004]
 Fatty acid synthase
  Component type
   BI364_10675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AOU98362
UniProt: A0A1D8IPH4
LinkDB All DBs
Position
complement(2231014..2231490)
Genome map
AA seq 158 aa AA seqDB search
MESFEASTLNSFNIQEIMNFLPHRYPFLLVDKVVDYVPGEWLTAVKNVTVNEPFFQGHFP
NRPVMPGVLILEAMAQATGLLAFKTRGEAPPPENYLYLFVSVDRARFKRQVIPGDQLVMR
VELLRVKRDMWKFSAEARVDGDLAAEAELMCAGREVMP
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggaatcatttgaggcgagtactttgaattcttttaatattcaggaaattatgaatttt
ctgccacatcgttatcccttcctgttagtggataaggtggtcgactatgtgccgggagaa
tggctgaccgcggtaaaaaacgtcacggtcaatgaacccttttttcaagggcacttccca
aatcgccccgtcatgcctggcgtgctgattttggaggccatggcccaggctactggactg
ctcgcattcaagacgcgtggagaagccccgccgccagaaaattacctgtatctcttcgta
tcggtcgatcgagcacgcttcaagcgacaagtgattccgggtgatcaactcgtcatgcgt
gtggaattgctgcgcgtgaagcgggatatgtggaaattttcggcggaagcgcgagtcgat
ggcgatttggccgcggaggccgagctgatgtgcgcgggacgagaggtgatgccttga

DBGET integrated database retrieval system