KEGG   Acidihalobacter prosperus: BI364_11835Help
Entry
BI364_11835       CDS       T04495                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aprs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BI364_11835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aprs02000]
    BI364_11835
Enzymes [BR:aprs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BI364_11835
Transporters [BR:aprs02000]
 Other Transporters
  Pores ion channels [TC:1]
   BI364_11835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AOU98552
UniProt: A0A1D8IQ13
LinkDB All DBs
Position
2473787..2474467
Genome map
AA seq 226 aa AA seqDB search
MLMPLELISFKLCPFVQRSVVTLLYKQVPFEITYIDLAAPPDWFLEISPLGKVPALRLDD
GNALFESAIINEYIDDITPPALHPSDPLVRARNRSWIQFGEQCIVDQYQLTVAKNEDDFE
AVRTRAQSNLAKVEAILGNGPWFNGTVFSLVDAAYAPIFMRYALIKPMDDVMPEADYPRL
NAWAEALLALPAVRQSVVGDFDTLLAAYIRKNSPYAAERLIAAVAA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgcctctggaattgatcagtttcaaactatgccccttcgtgcaacgcagcgtg
gtcacactcctgtacaaacaggtacccttcgagattacctacatcgacctggccgcgcca
ccggactggtttctcgaaatatcgcccctcggcaaggtgccggccctgcgccttgacgat
ggcaacgcattgttcgaatcggcgatcatcaacgaatatattgacgacattacgccaccc
gcactgcatccgtctgacccgctggtcagggctcgaaaccgcagctggatccaatttggc
gaacagtgcatcgtcgatcaatatcagctgaccgtcgccaaaaacgaggacgatttcgaa
gcggtgcgcacccgagcacagagcaacctggccaaggtcgaggcgatattgggtaacggc
ccctggttcaacggcaccgttttttcgctggtcgacgcagcctacgcaccgatattcatg
cgttatgcactgatcaagccgatggacgatgtcatgccagaagccgactacccacgactg
aatgcctgggccgaagcattgctcgcactacccgccgtacggcaatcggtagtcggggat
ttcgacaccttgctcgccgcctacatccgcaaaaacagtccttatgccgctgaacgcctg
attgccgccgtggctgcctga

DBGET integrated database retrieval system