KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_116Help
Entry
CFPG_116          CDS       T00792                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
aps00473  D-Alanine metabolism
aps00550  Peptidoglycan biosynthesis
aps01100  Metabolic pathways
aps01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aps00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CFPG_116
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CFPG_116
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CFPG_116
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aps01011]
    CFPG_116
Enzymes [BR:aps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CFPG_116
Peptidoglycan biosynthesis and degradation proteins [BR:aps01011]
 Precursor biosynthesis
  Amino acid ligase
   CFPG_116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 ATP-grasp CPSase_L_D2 ATPgrasp_ST ATPgrasp_YheCD GARS_A Whi5
Motif
Other DBs
NCBI-ProteinID: BAG83379
UniProt: B6YQA7
LinkDB All DBs
Position
135275..136249
Genome map
AA seq 324 aa AA seqDB search
MKNVAIVSGGYSSECVISLKSAEEVYLSIDKTRYNPYIVLITRNGWTVQGGNKTEFPINK
NDFSFIYKGKQIRFDFAYIIIHGTPGEDGLLQGYLDILNIPYSCCGVLSASITFNKYFCN
NYLRGFGVETAKSILLKQREQIISPERIIDKLGLPLIVKPNDGGSSFGVTKVTNITQIQL
AIRNAFNEGEGVLIESFIPGTEITCGYYKTKNKQVTLPITEIISKNDFFDFEAKYNPGMV
EEITPARISKKLTDEIQTLTAHIYDWVGAKGIIRIDYIISPKKEIKMLEVNTIPGMTATS
FIPQQIRAAGLNLKEILTEIIESI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtagcaatagtttccggagggtattcctccgaatgtgtgatttctttgaaa
agtgcagaagaagtttatttatccatagataaaacaagatataatccatacatcgttttg
attacaagaaatggatggactgtacaaggaggaaataaaacagagtttcctattaacaaa
aatgatttcagctttatttataaaggaaaacaaatacgattcgatttcgcatatatcatt
attcatggtacacccggagaagatggattattacaaggatatttagatatattgaacatc
ccttattcatgttgcggggttctgtcagcttctatcacgttcaataaatatttttgcaat
aattatttaagaggatttggagtagaaacagcaaaatccattctcctaaaacaaagagaa
caaataatatcacccgaaagaataattgataaacttggattgcctcttattgttaaacca
aacgatggtggatcaagttttggagtaacgaaagtaacaaatattactcaaatacagtta
gccattcgtaatgcattcaatgagggagagggagtacttatcgaaagttttataccagga
acagaaataacatgtggttactataaaacaaaaaataaacaagttactttgccaattaca
gaaataataagtaaaaatgattttttcgactttgaagctaaatataatcctggtatggta
gaagagattactcctgcacgaatatccaaaaaattaactgatgagatacaaacactaacg
gcacatatctatgactgggtaggagcaaaaggaattattcgtatagattacattatctct
ccaaaaaaagaaataaaaatgttagaagtaaatacaattccaggcatgactgctacaagt
tttattcctcagcaaatacgtgctgctggattaaatctcaaagagatactgactgaaatt
atagaatctatataa

DBGET integrated database retrieval system