KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_06810Help
Entry
APA01_06810       CDS       T00988                                 

Definition
(GenBank) hypothetical protein
  KO
K09774  lipopolysaccharide export system protein LptA
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Brite
KEGG Orthology (KO) [BR:apt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:apt02000]
    APA01_06810
Transporters [BR:apt02000]
 Other Transporters
  Pores ion channels [TC:1]
   APA01_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OstA
Motif
Other DBs
NCBI-ProteinID: BAH98830
UniProt: C7JEK0
LinkDB All DBs
Position
complement(702055..703161)
Genome map
AA seq 368 aa AA seqDB search
MRRLFSRSRPALRAASAVMAALPCAMLALSGTALAQAIDMSHGGQITVTAAGGFDWDQNQ
KKVTAYDQAKAIRGDVTVTADKLIAYYRKKAPVPGAPDGNAPAAADGAKPASVQAPAANG
TTPATPPASTDQPPPAPATNGSADAGGQKAAGGDDQDSGANEIFRLEAIGHVHIFTQTDQ
AWGDKAVYDMDQAVLVMTGKAMKLTTPQDVLTARDSMEYYSQQRISIGRGNATVTTNDQR
QIRADVLVGYSAPPDQNAQPQQQASNTNSNSSDPLSSGSGKLEKVNAFGHVWVHTQTEIV
TGERGVYVPDTGIARIVGNVHITRGPNQIQGAAAIINMHTGIATMTERPGSRVSGLVVPN
NGDTSDRK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgccttttttcccgctcccgccctgccctgcgtgctgcctctgccgttatggcg
gcactgccgtgtgccatgctggccctttctggcaccgcgctggcgcaggccattgatatg
tcccacggagggcagattaccgttaccgccgccggtgggtttgactgggaccagaaccag
aaaaaagttaccgcctacgatcaggcaaaagccatccgtggggatgttacggttacggca
gataagctaattgcctattaccgcaaaaaagcccctgtccccggcgcgccagatgggaat
gctccggctgcggcagatggtgcaaaaccggcaagcgtgcaggccccggcagccaacggc
accacaccggccacacctccggccagcacggatcagccgccaccagccccagccaccaat
ggcagcgcagatgcaggcggccagaaagccgccgggggggatgatcaggattccggcgcc
aacgaaattttccggcttgaagccataggccacgtgcacatcttcacccagaccgatcag
gcatggggtgataaagccgtgtacgacatggatcaggccgtgcttgtcatgaccggcaag
gccatgaagctgaccaccccgcaggatgtgctgacagcgcgggattcgatggaatattac
tcacaacagcgtatttccatcgggcgcggcaatgccaccgtcaccaccaatgatcagcgc
cagatccgggcagatgtgctggtgggctatagcgccccgcctgatcagaacgcccagcca
cagcagcaggccagcaacactaacagcaacagttcagatccgcttagcagtggttcgggc
aagctggaaaaggtaaacgcctttggccatgtgtgggtgcacacgcaaacagaaatcgtc
acgggggaacgcggggtatatgtgcctgatactggcattgcccgcattgttggcaatgtc
catatcacccgtgggccaaaccagattcagggcgctgccgccattatcaacatgcacaca
ggcatagccaccatgacagaacgccccggcagccgggtaagcgggttggttgtgcctaat
aacggcgatacgtcggacaggaaataa

DBGET integrated database retrieval system