KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_12160Help
Entry
APA01_12160       CDS       T00988                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
apt00010  Glycolysis / Gluconeogenesis
apt00020  Citrate cycle (TCA cycle)
apt00620  Pyruvate metabolism
apt01100  Metabolic pathways
apt01110  Biosynthesis of secondary metabolites
apt01120  Microbial metabolism in diverse environments
apt01130  Biosynthesis of antibiotics
apt01200  Carbon metabolism
Module
apt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APA01_12160
   00020 Citrate cycle (TCA cycle)
    APA01_12160
   00620 Pyruvate metabolism
    APA01_12160
Enzymes [BR:apt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     APA01_12160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: BAH99363
UniProt: C7JHA9
LinkDB All DBs
Position
complement(1271699..1272943)
Genome map
AA seq 414 aa AA seqDB search
MATEILMPALSPTMTEGKLARWLKKEGDTVNSGDVLAEIETDKATMEVEAIEEGILGRIL
IQEGAEGVAVNTPIAILVEEGEAVPDNIDTPKNVASAEPAPVPQPVASAPVAAQAAPAQR
ADKPVGRVVASPLARRIARQKNIDLAAIKGTGPNGRIVKRDVEAALNKAPSAGQVASALP
ASGGSSAVPHTTMRKVIARRLSESKATIPHFYVSIDVELDALLALRAQLNAMSPAEGADA
FKLSVNDMLIKASAVALKQVPEVNASYTEDAMILHEDADISVAVSLDDGLITPIVKQADR
KSLKDISQEAKDLIARARAGKLKPEEFQGGTFSISNMGMYGVKDFAAIVNPPQAAILAIA
AGKKQAVVKGNELAIATVMTVTLSVDHRVVDGAAAARWLSAFRTAVESPLSLVL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgaaattttaatgcccgccctttctcctaccatgacagagggcaaactggcc
cgctggctgaaaaaggaaggggacaccgtaaacagcggtgatgttctggccgagattgaa
accgacaaagccacaatggaagtagaagccattgaggaaggtattctgggccgcatcctt
attcaggaaggcgcagaaggtgttgctgtcaacacacctatcgccattctggtggaagaa
ggtgaggcggtgccagataacatcgacacgcctaaaaacgtggcgtctgctgagccagcc
cctgtgccgcaacctgttgcttctgcaccagtagcagcacaggccgcacctgcacagcgg
gcagataagcctgttggccgggttgtggcctctccacttgcgcggcgcattgcacgccag
aagaatattgatctggcagccattaaaggcactggcccaaatggccgtattgttaaacgg
gatgtggaagccgctcttaacaaagccccaagtgcagggcaggtggcttctgccttgcca
gcatctggtggcagcagtgcggtgccgcacaccactatgcgtaaggttattgcacgccgc
ctgagtgaatccaaagccaccattccgcacttctatgtctccatagatgtagaactggat
gcactactggctttgcgtgcgcagcttaatgccatgtctcccgcagaaggggctgatgcc
ttcaagctgtctgtaaacgatatgctcattaaggcttctgccgttgcccttaagcaggtg
ccggaagtgaacgcgtcttacaccgaagatgccatgatcctgcacgaagatgcagatatc
tcggttgcggtttctctggatgatgggctgatcacgcctatcgtcaaacaggcagaccgc
aagagcctgaaagatatcagtcaggaagccaaggatctgattgcccgcgcccgcgctggc
aagctgaagccggaagaattccagggtggtacgttctccatttccaatatggggatgtac
ggcgtgaaagactttgccgccattgttaacccgccgcaggctgccattctggctattgca
gcaggtaaaaaacaggctgtggtaaaagggaatgaactggctattgctacagtcatgacc
gttaccctctcggtggatcaccgtgtggtggatggtgcggcggctgcgcgttggctttct
gctttccgtacagcggttgaatctccgctttcactcgttctctaa

DBGET integrated database retrieval system