KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_16650Help
Entry
APA01_16650       CDS       T00988                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
apt00620  Pyruvate metabolism
apt00680  Methane metabolism
apt01100  Metabolic pathways
apt01120  Microbial metabolism in diverse environments
apt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    APA01_16650
  Energy metabolism
   00680 Methane metabolism
    APA01_16650
Enzymes [BR:apt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     APA01_16650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAH99794
UniProt: C7JBQ0
LinkDB All DBs
Position
1799491..1802289
Genome map
AA seq 932 aa AA seqDB search
MTMDNTSSPSRLDSILASATAHPDAGTAAEGTNPVMGIALRLGEALSREEISQTDITSLV
QKLRDEAFLARARKLHRYVGGATTEATKEKFRNVARAIAEACPTGSFAEYQAHISAIQFA
AVFTAHPTFALSNPVYAALAESASQAIPPQEAPFFETHRRAAPPTLEEEFTLAAQAITRA
RDAMDLLATALLEEAATRWPQEWTSLKPCPVIATSWVGYDTDGRTDIGWWDTLRLRLRMK
LFQLMRLESQIMHEGLLAPELTEKLQRAIACVKEQISAVPAGPSDAQAVAHFAKLLVSQR
NTALTHAAELEGLLETAINSAPPSARIPLAVARAGFLAHGLGLAHTHVRLNASQIHNFVR
QKLNLLDDPNNPAHRRALLNQINEALESVTPVPVDFGALLSDPSSAGRLMMTIAQMVKFI
DSDTPVRFLIAETETGYTLLSALWVASCFGVADKIEISPLFETEDALMNGEHIVEEALRS
PAWRAYIRRIGRICFQFGYSDSGRYVGQLAATYLIERLRLRIHDLLVRWDMQDITVVFFD
THGESIGRGAHPFRMADRLDYLSPPHVRARFKTTGIACREETAFQGGDGYLLFGTPELAG
ATLATIAENLFLPLRQEEDPIYDQPDFSADFFSSISEGMKKLVEDPGYAALLGAFGPSLI
DRTGSRPPARQSAESATHKRITHPSQLRAIPNNAILQQLGWCANTLQGLGAAVRRHPETF
ETFRTSSPRFHRALDFAQHGLTCSDDKVLKSVVCLLDPGFWLDRATEEKTPARRKAFLSL
MQDLEKLDLSAELLTMFRRIQADHLALREAWEHAPRTEPQIRLLHAIRIMLIEQIWLLAC
RVPFFMPRGGFNHDVMMQHILCLDIPAVLEELEHIFPTGTGPTNLDFHEPRGPREEGIYE
REHRDIFVPMQRMFELIREISVAIMHNIGAFG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgactatggataacacatcttctccttcccgtttggacagtatccttgcgtccgctact
gcgcacccagatgctggcacagcagctgaaggcacaaatcctgtaatgggcattgcgctc
cgacttggagaagctttgagccgcgaggaaatctcacaaacagatattacaagccttgtg
caaaagctgcgcgatgaagcctttctggcgcgcgcccgtaagctgcatcgctacgtaggt
ggcgcgacaacggaagccactaaagagaagttccgcaatgttgcacgtgcgatagccgaa
gcatgccctactggctcttttgcagagtatcaggcacacatctctgccattcagtttgct
gcggtctttactgcgcaccccacgtttgccctgagcaaccctgtgtatgcggctttggca
gaaagtgcatctcaagccattcccccgcaggaagcaccgttttttgaaacgcacagacgc
gctgccccacccacgctggaagaagaatttacactggccgcgcaagccataacccgtgcg
cgggatgccatggatctgctggctactgccctgctggaagaagcggccacacgttggccg
caggaatggacaagcctgaagccctgcccggttattgcaaccagttgggttggctatgat
accgatggccgcactgatattggctggtgggacaccctgcgcctgcgcttgcgcatgaag
ctgttccaactgatgcggttggaaagccagatcatgcacgagggcttgctggccccagaa
ctaacagaaaagctgcagcgggctattgcctgcgtaaaagaacagattagcgctgttcct
gctggcccaagtgatgcccaggctgtagcccattttgcaaaacttctggtttctcagcgc
aacacagcgctcacacacgcagcagaattggagggcttgcttgaaaccgccatcaatagc
gcgccaccctctgcccgcattccactggctgttgcccgggcaggttttctggcgcatggg
ctggggcttgcgcatacgcatgtgcgacttaatgcctcccagatacacaacttcgttcgc
cagaagctgaacctgctggatgaccccaacaacccggcacatcgtcgggcattgttgaac
cagattaacgaagcgctggaatctgtaacacctgttcctgtggactttggcgcgctgctg
agcgacccctccagtgctggacggctgatgatgaccattgcgcaaatggtcaaatttatc
gattccgatacacctgttcgtttcctgattgcagaaacagaaaccggttacacattgctc
tcggccctgtgggtggcctcctgctttggtgtggcggataaaattgaaatctcgccgctg
tttgaaacggaagatgcgctcatgaacggtgagcacattgtggaagaagccctgcgctct
cccgcatggcgtgcctatatccgccgtattggccgtatctgcttccagtttggatattcc
gattctggccgatatgttggccagttggcggcaacgtatctgatagagcgcctgcgcctg
cgtattcatgatctgctggtgcggtgggacatgcaggatatcaccgtggtgttttttgat
acgcacggtgaaagcattggtcgcggcgcgcaccccttccgtatggcggatcggctggat
tacctttctccgccgcatgtgcgtgcacggtttaaaaccaccggcattgcctgccgtgag
gaaacggcttttcagggtggagatggctacctgctttttggcacgccagaactggcgggc
gctacgttggccaccattgcggaaaacctatttctgcccttacggcaggaagaagacccc
atttatgatcagcctgatttttcggctgatttcttctccagcattagcgagggcatgaaa
aaactggtggaagaccccggttatgctgcgcttctgggcgcttttgggccatcccttatt
gatagaaccggctctcgtccccctgctcggcagagtgcagaaagcgccacccacaagcgc
attacccaccccagccagctacgcgccatccctaacaacgcaattcttcagcagctcgga
tggtgcgccaacaccttgcagggcttgggggcagccgtacgccgccacccggaaaccttt
gaaacattccgcacatccagcccgcgctttcatcgtgctctggattttgcccagcatggc
ctgacctgctcggatgataaggtgctgaaaagcgttgtctgtttgctagaccccggcttc
tggctcgaccgcgccacagaggaaaaaacgccagcacgccggaaggcttttctctccctg
atgcaggatctggaaaagcttgatctgtctgccgaactgctcaccatgttccgccgtatt
caggctgaccatcttgcgttgagagaagcgtgggaacatgcaccgcgcacggaaccacag
atccggcttctgcacgccattcgtattatgcttattgagcagatatggctgctggcatgc
cgtgtacccttcttcatgccacgtggcggctttaaccatgatgtcatgatgcagcacata
ctgtgtctggatattccggcagtgttggaagagcttgagcatatcttccccaccggcacg
ggcccaaccaaccttgattttcatgaaccacgtggcccgcgcgaagaaggtatttacgag
cgagagcacagagacatctttgtacccatgcaacggatgtttgaacttattcgtgaaatc
agcgtcgccatcatgcacaatattggcgcttttggctga

DBGET integrated database retrieval system