KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_25210Help
Entry
APA01_25210       CDS       T00988                                 

Definition
(GenBank) acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
apt00061  Fatty acid biosynthesis
apt00620  Pyruvate metabolism
apt00640  Propanoate metabolism
apt01100  Metabolic pathways
apt01110  Biosynthesis of secondary metabolites
apt01120  Microbial metabolism in diverse environments
apt01130  Biosynthesis of antibiotics
apt01200  Carbon metabolism
apt01212  Fatty acid metabolism
Module
apt_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:apt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APA01_25210
   00640 Propanoate metabolism
    APA01_25210
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    APA01_25210
Enzymes [BR:apt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     APA01_25210
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     APA01_25210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 LAL_C2 ATPgrasp_Ter ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: BAI00627
UniProt: C7JG57
LinkDB All DBs
Position
2731119..2732462
Genome map
AA seq 447 aa AA seqDB search
MFSKILIANRGEIALRILRACRELGIKTVAVHSTADEDAMHVRLADEAVCIGPPASRDSY
LNVAAILSAATITGAEAIHPGYGFLSENADFAETVEAHGLTFIGPTAEHIRMMGDKITAK
TTMQMLGVPLVPGSDGELTSLEEAREVADKVGYPVLIKAAAGGGGRGMKVAQTAGDLEDA
WKMARAEARAAFGNDAVYLEKYMDRPRHIELQILGDNYGNVVHFGERDCSLQRRHQKLLE
EAGSPALTAEQRDAIGQTATQALSKMGYRNAGTLEFLYQDGQFCFIEMNTRLQVEHPVTE
MVCDVDLVREQIRLAAGEQLGYTQKDISFSGHAIECRINAEDPDSFTPCPGTVAVYHPPG
GLGVRVDSALYTGYRVPPFYDSMIAKLIVHAPTREQAIARMQRALDEFVVEGIKTVIPLH
RRILEDPEFQKGEYTIHWLEQFTAKPH
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgttttccaagatccttatcgccaaccgaggcgaaattgcccttcgtatcctgcgcgcc
tgccgggagctagggatcaagaccgtagcggtacattccactgcagatgaagacgccatg
cacgttcggctggcagatgaagctgtttgcatcgggccgccagcctcacgcgattcctac
ctgaatgtggctgcaattctttctgcagccaccattacaggggcggaagccattcatccc
ggctatggttttctttcagaaaatgcagattttgccgaaacagtggaagcgcatggcctg
acctttattggcccaacggcggaacatatccgcatgatgggggataagattaccgccaaa
accaccatgcagatgctgggcgtgcctttggtgcccggttctgatggtgagctgacaagc
ctggaagaagcccgcgaagttgccgataaagtcggctatcccgtgctgatcaaggctgcg
gctggcggtggtggccgtggcatgaaggtcgcccaaacggctggtgatctggaagacgcc
tggaaaatggcccgcgccgaagcacgcgctgcttttggcaacgatgccgtttatctggaa
aaatacatggaccggccgcgccatattgaactccagatactgggggacaattacggcaac
gtggttcattttggcgaacgcgactgctctctccagcgccgtcatcagaagcttctggaa
gaagccggctctccggcccttacagcagagcagcgtgatgccattggccagacagccacg
caggctctctctaaaatgggctatcgtaatgcgggcacgctggaatttctgtatcaggat
ggtcagttctgcttcatcgaaatgaacacgcgccttcaggtggaacatccagttaccgaa
atggtttgtgatgtagacttggtgcgtgagcagattcgcttggccgctggtgagcagctt
ggctatacgcaaaaagatatttcattttctggccacgccattgaatgccgtatcaatgcg
gaagacccagacagctttaccccctgccctggcacggttgctgtttaccacccacccggc
ggcttgggtgtgcgcgtagatagcgccctttacaccggctaccgcgtgccacctttttac
gacagcatgattgccaagctgattgtgcacgctcccacgcgtgaacaagccattgcccgt
atgcagcgtgctttggatgaatttgtggtggaaggtattaaaaccgttattccgctgcac
cgtcgtattctggaagatcctgaattccagaaaggtgaatacaccattcattggttggaa
cagtttacagccaagccacactaa

DBGET integrated database retrieval system