KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_25330Help
Entry
APA01_25330       CDS       T00988                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
apt00250  Alanine, aspartate and glutamate metabolism
apt00280  Valine, leucine and isoleucine degradation
apt00410  beta-Alanine metabolism
apt00640  Propanoate metabolism
apt00650  Butanoate metabolism
apt01100  Metabolic pathways
apt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    APA01_25330
   00650 Butanoate metabolism
    APA01_25330
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APA01_25330
   00280 Valine, leucine and isoleucine degradation
    APA01_25330
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APA01_25330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:apt01007]
    APA01_25330
Enzymes [BR:apt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     APA01_25330
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     APA01_25330
Amino acid related enzymes [BR:apt01007]
 Aminotransferase (transaminase)
  Class III
   APA01_25330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAI00639
UniProt: C7JG69
LinkDB All DBs
Position
2744987..2746273
Genome map
AA seq 428 aa AA seqDB search
MATNKDLLNRRTNAVPRGVATSTPVFADRAENAEIWDVEGKRYVDFAGGIAVLNVGHRHP
KVMDAVKKQLDRFTHTAFQVSAYEPYIELAEKLNARAPFSGDAKTIFFTTGGEATENAVK
IARAATGRNGVIAFCGGFHGRTLLASALTGKVLPYKAPFGTLPGEVYHIPFPDGHDITVE
DSLKMLNFLFAADISPNNVAAIIIESVQGEGGFRVAPTALLKHLRAICDQHGIKLIADEV
QSGFARTGKLFGIEHSGVEPDLVCIAKSLAGGFPLSGVIGRAELMDSVPPGGLGGTYAGA
PLGCAAGLAVLDIIEEEKLLDRANSMGERLKARIAGWHKRTDMLPVSMPRGLGAMVAFDI
LERHEGMEQRKGFGSKLCARACEKGLILLACGVQGATIRILTPLTASDELVDEGLDIIEQ
ILLEEAKA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaataaagaccttctgaaccgccgcaccaatgctgtgccgcgcggtgttgcc
acttccacccctgtttttgcagaccgcgcagaaaatgccgaaatctgggatgtggaaggc
aaacgctatgttgattttgccggcggcattgccgttctgaacgttggccatcgccaccca
aaagtgatggacgctgttaaaaagcagctagaccgttttacccacacggcttttcaggtt
tctgcttacgagccctatattgaactggctgaaaagctgaacgcccgcgcaccgttttct
ggcgatgccaaaaccattttcttcaccacgggtggggaagccacagaaaacgccgtaaaa
attgcgcgtgccgcaactggccgtaatggcgtgattgctttctgcggtgggttccacggt
cgcacgctgctggcttctgcacttacgggtaaagttctgccttacaaggcaccttttggc
accctgccgggcgaagtttaccacatccccttccctgatggtcatgacatcacggtggaa
gacagcctgaagatgctgaacttcctgtttgcggccgatatctcccccaacaatgtggcc
gccattattattgagtctgtgcagggtgaaggcggcttccgcgttgcccctactgcactg
ctcaaacacctgcgcgcaatttgcgaccaacacggcattaaactgattgccgatgaagtg
cagagcggctttgcccgtactggcaagctgtttggtattgaacattctggcgtagaaccg
gatctggtgtgcattgccaaatctctggcaggtggcttcccgctttccggcgtcattggc
cgtgcggaactgatggattccgtgcctccgggtggcctgggtggcacatatgctggtgct
ccgctgggctgtgctgctggtctggctgtgttggatattattgaagaagaaaagctgctg
gatcgcgccaacagcatgggcgaacgcctgaaagcccgcattgcaggctggcacaagcgc
acagatatgctgcctgtcagcatgccacgtgggctgggcgcaatggttgcctttgatatt
ctggaacgccatgaaggtatggaacagcgcaagggctttggttccaaactatgtgcccgt
gcctgtgaaaaaggcctgatcctgttggcctgtggtgtgcagggcgctacaatccgtatc
ctgacaccgctgactgcatctgatgaactggttgatgaaggcttggacatcatcgaacag
attctgctggaagaagcaaaagcctga

DBGET integrated database retrieval system