KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_25380Help
Entry
APA01_25380       CDS       T00988                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
apt00970  Aminoacyl-tRNA biosynthesis
apt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    APA01_25380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:apt03029]
    APA01_25380
Enzymes [BR:apt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     APA01_25380
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     APA01_25380
Mitochondrial biogenesis [BR:apt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    APA01_25380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BAI00644
UniProt: C7JG74
LinkDB All DBs
Position
2749625..2751079
Genome map
AA seq 484 aa AA seqDB search
MSYVIEGKTGPWEIVVGLEVHAQVISQSKLFSGASTKFGGDPNTQVSLVDAAFPGMLPVI
NKECVAQAIRTGLGLNAQINLFSRFDRKNYFYADLPQGYQISQFEHPIIGKGSIEIELQS
GETRQIGITRLHLEQDAGKLLHDQDPTKSFVDLNRAGVALMEIVSEPDIREPEEAGAYLR
KLRQILRYLGTCDGNMEEGSMRADVNVSVRKAGEPFRTRCEIKNVNSIRFVMQAIEVEAT
RQIEIWENGGEVDQETRLFDPGRGETRTMRSKEDAHDYRYFPDPDLLPLVVEQAWVDELK
SKLPELPDAKRARFQKDYGIPSYDAGVLVAEQAVADFYETVAKGRDGKLAASWVIGDLFA
ALNRTSNTIETSPVSAASLGKMLDLIADGTINGKIAKEVFEDMVETGDSPDAIVERKGLR
QVTDTGVIDAAIAAILEKHADKVAEYRGGKDKLFGFFVGQVMKETKGKANPALVNSALKA
QLDG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgtaattgaaggtaaaaccggcccgtgggaaattgtggtggggctggaagtg
catgcacaggttatcagtcagtccaagctgttttccggtgcttccacaaaatttgggggt
gacccgaacacacaggtcagccttgttgatgcggccttccccggtatgctgcctgttatc
aacaaggaatgcgtggcgcaggccatccgcaccgggttggggctgaatgcccagatcaac
ctgttcagccggtttgaccgtaaaaactacttttacgccgacctgccgcagggttaccag
atcagccagttcgagcacccgatcatcggcaagggttctatcgaaattgagcttcagagc
ggcgaaacacgccagattggcattacccgcctgcatctggaacaggacgccggtaagctg
ctgcatgatcaggaccccacaaaatcctttgtggacctgaaccgcgccggtgtggccctg
atggaaattgtgagcgaacccgatattcgcgaaccagaagaagccggggcctacttgcgt
aagttgcgccagattctgcggtatctgggcacgtgtgatggcaacatggaagaaggctcc
atgcgtgcggacgtaaacgtttctgtgcgcaaagcgggcgaacccttccgcacccgttgc
gagatcaagaacgtcaactccatccgctttgttatgcaggccattgaagtggaagccaca
cgccagattgaaatctgggaaaacggtggcgaagttgatcaggaaacacgcctgtttgat
ccaggccgcggtgaaactcgcaccatgcgttccaaggaagatgcgcatgattaccgctat
ttcccagatcctgacctgctgccgctggtggtagaacaggcatgggtggatgaactgaaa
tccaagctgccagaactgccggacgcaaagcgtgcacgcttccagaaagactacggcatt
ccatcctacgatgctggcgtgctggttgcagaacaggctgtggctgatttttacgaaaca
gtggccaaagggcgcgacggcaagttggcggcaagctgggtaattggtgatctgtttgca
gccctgaaccgcaccagcaacaccattgaaaccagccctgtcagtgcggcctccttgggt
aaaatgcttgatctgattgctgatggcaccatcaacggtaagattgccaaggaagtgttt
gaagacatggtggaaaccggtgatagcccggatgccattgtggaacgcaaaggcctgcgg
caggtcaccgacacaggtgtgattgatgccgccattgccgccattttggaaaaacatgcg
gataaggtggcagaataccgtggcggcaaagacaagctgttcggattctttgtgggacag
gtcatgaaggaaaccaaaggcaaggcaaaccctgctctggtaaattcggccctgaaggct
cagctagacggctaa

DBGET integrated database retrieval system