KEGG   Acetobacter pasteurianus IFO 3283-07: APA07_25350Help
Entry
APA07_25350       CDS       T01813                                 

Definition
(GenBank) Holliday junction resolvase YqgF
  KO
K07447  putative holliday junction resolvase [EC:3.1.-.-]
Organism
apu  Acetobacter pasteurianus IFO 3283-07
Brite
KEGG Orthology (KO) [BR:apu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    APA07_25350
Enzymes [BR:apu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     APA07_25350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvX
Motif
Other DBs
NCBI-ProteinID: BAI06737
LinkDB All DBs
Position
complement(2745858..2746322)
Genome map
AA seq 154 aa AA seqDB search
MTLLSLTDLVATLPRHARLLGIDPGKKQVGLALSDVSRMVASPFQTVKRGKLGQMASFIR
DLAKEHEIGGMVVGIPLSLDGSFGPAAQASRDWALALSEQTGLPVCQWDERLSSSAVNRM
LIDEADLSRARRAEMVDRLAAAYILQAALDSLPR
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgacactgcttagcctgacagaccttgttgcaaccctgcccagacacgcacgcctgctg
gggatagaccccggcaaaaagcaggtggggctggcgctttccgatgtttcgcgcatggtg
gcctcaccattccaaacagtaaagcgcggtaagctggggcaaatggccagttttattcgt
gatcttgccaaagaacacgaaattggcggcatggttgtggggattcccctttctttggat
gggtcctttggccctgcagcgcaggccagccgtgattgggcgcttgcgctttcggaacag
acaggtttgcctgtgtgtcagtgggatgagcgcctttcctcatccgcagtgaatcgtatg
cttattgatgaggctgatctctcccgcgcgcgccgggcggaaatggtggatcggctggct
gcagcatacatcttgcaggccgcactggactctctgccacgttaa

DBGET integrated database retrieval system