KEGG   Atopobium parvulum: Apar_1345Help
Entry
Apar_1345         CDS       T00983                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
apv  Atopobium parvulum
Brite
KEGG Orthology (KO) [BR:apv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:apv01001]
    Apar_1345
Enzymes [BR:apv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Apar_1345
Protein kinases [BR:apv01001]
 Serine/threonine kinases: Other
  Bacterial family
   Apar_1345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Seadorna_VP7 RIO1 Kinase-like Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: ACV51769
UniProt: C8W8H8
LinkDB All DBs
Position
1515012..1516937
Genome map
AA seq 641 aa AA seqDB search
MPGRMLGGRYQVQDKIGTGGMATVYRGQDQVLGRTVAIKMMLPQYANDPSFAARFKQEAQ
AAAALSSPYIVSVYDWGKDGESYYIVMEYLRGTDLKSGIRKHGALDSRKVAQIGSQIAQA
LSVAHRHDIIHRDIKPQNIMVQPDGNIKVMDFGIARAKNSSLTTDNSVLGTAHYVSPEQS
TGKPLGPTTDIYSLGIVMYEAATGRVPFVGDDAISVAMKQVNEAPQPPSLINPNIDPALE
AIILRCMEKNPGDRYQSADELARALRDFIAGRATIPSNTTVSPRIVTPPQPTSRLDRRGI
EGSNTYMTRGGDTGRLNRVHSREEADELDKRENNRHKRNIILGILAALVVVALAGFAIAH
ILGNTSQQYLVPQFVGQTKDQATQALNASGSHFKLGTVTESYSDSAPEGQVIDQTPSANR
QAPEGTTVNLVISKGAKPAAAVKVPDLTNKSPSEAESALAAVGLKARNGDSVESDNVAVG
YVATQEPAAGSDAKAGDTITYHLSSGKGKVDVPDVTEMTSERASDVLKDAGFKVETQQQP
SSSVPEGRVISQSPANGKADKGSTVTIVVSTGAQSGSVPNVVGKDFETAQTTLENAGFQV
NTVWVYDDNVATGNVVGQTPSSAVPGATITIRVSSGPRPSV
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtagaatgctcggtgggcgttaccaggttcaagacaaaattggtaccggtgga
atggcaaccgtttaccgcggacaggaccaagttcttggtcgtactgttgccatcaaaatg
atgctgccacagtacgcaaatgacccgtcctttgctgctcgttttaagcaggaggcacag
gcagcggcggcgctctcaagtccatacattgtctcggtctatgactggggcaaagacggc
gagtcttactacattgttatggagtatctgcgcggtacagaccttaagagcggcatccgt
aagcatggagctcttgattcccgtaaggtcgctcagattggctctcagattgcccaggcg
ctctctgtagcacaccgtcacgacatcattcaccgtgacatcaaaccacaaaacatcatg
gtccagccagatggcaacattaaggtcatggactttggcattgctcgtgcaaagaacagc
agtctaaccaccgataactctgttctcggtaccgctcactatgtttctccagagcaaagt
accggcaaacctttgggaccaaccaccgatatctattccctgggtattgtcatgtacgaa
gctgctactggtcgcgttccctttgttggcgacgatgcaattagcgttgccatgaagcaa
gtcaatgaggctcctcagccaccatcgctcattaatcccaacattgaccctgctctcgag
gcaatcatccttcgctgcatggagaaaaatccaggggatcgttaccagagcgctgacgag
cttgctcgcgctcttcgcgatttcattgctggtcgtgccactattccaagtaacactact
gttagccctcgcattgtgacgccgcctcagccaacttctaggcttgatcgccgcggcatc
gaaggctccaacacctacatgactcgaggtggcgatactggtcgcttgaaccgcgttcat
tctcgtgaagaagctgatgagctggacaagcgcgagaataatcgtcacaagcgcaatatt
atccttggtattctagctgctttggttgtcgtagctcttgctggttttgctattgcacac
atcctcggcaacacctcccagcagtacctggttccgcagtttgttggacaaacaaaagac
caagcaactcaggcgctaaatgcatctggcagccactttaaactaggaactgtcacagaa
agctatagcgattctgctcctgaaggccaagttatcgaccagacaccaagcgctaacaga
caggctcctgagggaaccactgttaaccttgttatctctaaaggcgctaaacctgctgcg
gcagttaaggtacccgatctcactaacaagagtccatcagaggccgaatcggcccttgct
gctgttggtctcaaagcaagaaatggtgattcggttgagtcggacaacgtagctgttggt
tacgttgcaacacaggagccagctgcaggtagcgacgctaaggctggcgacaccatcacc
tatcatttgtcttctggtaagggtaaggtagacgtcccagacgtcacggagatgacttct
gagcgcgcgtctgacgttctgaaagacgctggatttaaggtagaaactcaacagcagcct
tcatcaagcgttcctgaaggccgtgttatctcccaatccccagctaacggcaaggcagat
aaaggttctactgtaactatcgttgtttctactggtgctcagagcggatctgttccaaat
gttgttggcaaagactttgagaccgctcagaccacgctcgaaaacgctggcttccaggtc
aatactgtttgggtctatgacgacaacgttgccaccggtaatgttgttggccagacgcca
tcaagcgctgtacctggcgctactatcaccatccgcgtatccagtggaccgcgaccatca
gtgtaa

DBGET integrated database retrieval system