KEGG   Atopobium parvulum: Apar_1360Help
Entry
Apar_1360         CDS       T00983                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
apv  Atopobium parvulum
Pathway
apv00473  D-Alanine metabolism
apv00550  Peptidoglycan biosynthesis
apv01100  Metabolic pathways
apv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:apv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Apar_1360
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Apar_1360
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Apar_1360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apv01011]
    Apar_1360
Enzymes [BR:apv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Apar_1360
Peptidoglycan biosynthesis and degradation proteins [BR:apv01011]
 Precursor biosynthesis
  Amino acid ligase
   Apar_1360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACV51784
UniProt: C8W8J3
LinkDB All DBs
Position
complement(1536456..1537415)
Genome map
AA seq 319 aa AA seqDB search
MTREELKKLHVAVVSGGWSDEHEIAMESGKQCAAALKEAGFINVDLLDVAEKDFVVALAQ
GDYDVVYVAMHGRFGEDGCIQGLLEILHIPYTFSGVLASAMGTEKELSKLMYRQAGIPTP
RGIDVPSGTVFTDEQVDKLIEDLGFPMFVKPSGNGSSYGVTRVTSREELPAALKLAGEQG
ERILIEECVVGTEITVPVIGNDNPTALPIVEIVTGDEFYSIKTKYEPASLHHVIPARLEP
AVYARAQELAIKAHNALGCRGVSRSDFIVTEDGEPVVLETNTIPGMTARSLLPDSARTGG
IDFPELCTRFIEFALEDRQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtgaagagttaaaaaaacttcatgtagcagttgtttcaggcggctggtcagac
gagcatgagattgcaatggagtctggcaagcagtgtgcagcagcacttaaagaggccggc
tttatcaatgttgacctgcttgatgttgcagagaaagactttgtggttgcccttgctcag
ggtgattatgatgtcgtgtacgttgcaatgcatggccgttttggtgaggatggctgcatc
cagggtcttcttgagattctgcacattccatacacgttttcgggcgttcttgcgtctgct
atgggaacagaaaaagagctgtcgaagcttatgtataggcaggcaggcattccaactcct
aggggtattgacgttccttcaggcactgtctttacagatgagcaagttgataagcttatt
gaggacctcggcttcccaatgtttgtcaagccctctggcaacggctccagctacggtgtt
acgcgcgttacttcgcgagaagagcttcccgctgcacttaaacttgcaggtgagcagggc
gagcgtattctgattgaggagtgtgtagtaggaacagagattactgttcccgttattggt
aacgacaacccaaccgctctaccaatcgttgagattgttactggtgatgagttctacagt
attaagacaaaatacgagcctgcatctttgcaccacgttattcccgctcgtcttgagcca
gcagtgtatgcgcgtgcccaggagctggcaattaaggcccacaatgcgcttggttgccgc
ggtgtttctcgtagtgactttattgttacagaagacggtgagccagtagtgcttgagaca
aacaccatccctggtatgactgcacgttctttgctgcctgattctgctcgtaccggcggt
attgatttccctgagctctgtactcgatttattgagtttgcgcttgaggatcgtcagtag

DBGET integrated database retrieval system