KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_00330Help
Entry
APA42C_00330      CDS       T01818                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
apw00020  Citrate cycle (TCA cycle)
apw00190  Oxidative phosphorylation
apw00650  Butanoate metabolism
apw01100  Metabolic pathways
apw01110  Biosynthesis of secondary metabolites
apw01120  Microbial metabolism in diverse environments
apw01130  Biosynthesis of antibiotics
apw01200  Carbon metabolism
Module
apw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
apw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:apw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APA42C_00330
   00650 Butanoate metabolism
    APA42C_00330
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    APA42C_00330
Enzymes [BR:apw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     APA42C_00330
    1.3.5.4  fumarate reductase (quinol)
     APA42C_00330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAI16478
LinkDB All DBs
Position
29641..31452
Genome map
AA seq 603 aa AA seqDB search
MNANTSPSRGAYRIVDHAYDVVVVGAGGSGLRATLGMGAAGLSTACVTKVFPTRSHTVAA
QGGIGASLGNMAEDNWRWHMYDTVKGSDWLGDQDAIEFMCREAVPAVRELEHFGVPFSRT
EDGKIYQRPFGGHMSDYGKAPVPRACAAADRTGHAILHTLYQQCLKHNVEFFVEYFAIDL
IMDEEGECRGVMAWCQDDGTIHRFNAKMVVLATGGYGRAYQSCTSAHTCTGDGNGMAMRA
GIPTQDMEFVQFHPTGIYPAGCLLTEGCRGEGGYLTNSEGERFMERYAPTAKDLASRDVV
SRAMTIEIKEGRGCGPKKDHIMMHLEHLGSDLLHQRLPGIIETARIFAGVDVTKEPVPVL
PTVHYNMGGIPTNIHGEVVRPTPDNPDAVVPGLMAVGEAACVSVHGANRLGTNSLLDLIV
FGRAASRRAAEVVKPTDFTRPLPAGAGEAALDRLDRLRYAKGGTKVSALRERLQRDMQTH
AAVFRTQESLQEGVDKIRDIWTGVSDISVADSSLIWNSDLMEALEFENLLANATVTLESG
LARHESRGAHARDDYPDRDDKEWLKHSVSWLDDKGGVKLTYRPVHMKTLTDDVQVFPPKK
RVY
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccaatacctctccgtcacggggagcttaccgaattgttgatcacgcttatgat
gttgtggttgtgggagcaggtggttcgggcctgcgtgcaacgttgggaatgggcgccgca
gggctaagcaccgcatgcgttaccaaggtttttccaacacgtagccatactgtggctgca
caggggggcatcggggcttctctggggaacatggccgaagataactggcgctggcatatg
tatgacaccgtaaaggggtctgactggctgggcgatcaggacgccattgaatttatgtgc
cgtgaggccgtgcctgctgtgcgcgaactggagcactttggtgtgccgttctcccggacg
gaagatggcaagatctatcagcgccccttcggtgggcatatgagcgattatggcaaggcg
cctgtgccacgcgcctgtgctgcggctgaccgtaccggccatgccattttgcatacgctg
tatcagcagtgcctcaagcacaatgttgaattttttgtcgaatattttgccattgacctc
atcatggatgaggaaggtgaatgccggggcgtgatggcctggtgccaggatgatggtaca
atccatcgtttcaacgccaagatggttgtgctggccaccggcggttatggccgtgcgtac
cagtcctgcacctctgcccatacctgtacgggtgatggtaacggtatggccatgcgtgcg
ggtattcctacgcaggatatggaatttgtgcagttccaccccaccggtatctatccagca
ggctgcctgctgacagaaggctgccgtggtgaaggtggttatctgaccaactccgaaggc
gaacgctttatggagcgttatgcgccaacggccaaggatctggcctcgcgcgatgtggtt
tctcgcgccatgaccatcgagatcaaggaaggccgtggctgtggtccgaaaaaagaccac
atcatgatgcaccttgagcaccttgggtctgatcttctgcaccagcgtttgccgggtatt
attgaaacggcacgcatctttgccggtgtggacgtgaccaaggagcccgtgccggttctg
ccaaccgtgcattataatatgggtggtattcccaccaatattcatggtgaagtggtgcgc
ccaactccggataacccggatgcagttgtgccgggcttgatggctgtgggtgaagcggct
tgtgtttccgtgcatggtgcaaaccgtctaggcacaaactctctgctggatcttatcgtg
tttggccgtgctgcctcccgtcgtgctgcggaagtggtgaagccaacagactttacccgt
ccgctacctgctggtgctggtgaagctgcgctggatcggctggaccggctgcgttacgcc
aagggtggcaccaaggtttctgccctgcgtgagcgcttgcagcgtgatatgcaaacacat
gctgctgtgttccgtacacaggaaagcctgcaggaaggcgtggacaagattcgcgatatc
tggaccggtgtgagcgatatctctgtggcagattcctccctgatctggaacagcgatctg
atggaagcgctggagtttgaaaacctgctggcaaacgccactgtcacgctggaaagcggc
cttgcacggcatgaaagccgtggggcacacgcgcgggatgattatcctgaccgtgatgac
aaggaatggctcaagcattccgtatcgtggctggatgacaagggcggcgtgaagctgacc
taccgtccggtgcatatgaagaccctgaccgatgatgtgcaggtcttcccacccaaaaag
cgcgtttactga

DBGET integrated database retrieval system