KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_00340Help
Entry
APA42C_00340      CDS       T01818                                 

Definition
(GenBank) succinate dehydrogenase Fe-S protein subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
apw00020  Citrate cycle (TCA cycle)
apw00190  Oxidative phosphorylation
apw00650  Butanoate metabolism
apw01100  Metabolic pathways
apw01110  Biosynthesis of secondary metabolites
apw01120  Microbial metabolism in diverse environments
apw01130  Biosynthesis of antibiotics
apw01200  Carbon metabolism
Module
apw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
apw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:apw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APA42C_00340
   00650 Butanoate metabolism
    APA42C_00340
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    APA42C_00340
Enzymes [BR:apw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     APA42C_00340
    1.3.5.4  fumarate reductase (quinol)
     APA42C_00340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-ProteinID: BAI16479
LinkDB All DBs
Position
31489..32271
Genome map
AA seq 260 aa AA seqDB search
MVELRLPRNSTIGKGKTFPAPAGAKNVRTFRIYRWTPDDDKNPVIDSYELDLDTIGPMVL
DAIIHIKNEIDPTLTFRRSCREGICGSCAMNIDGENTLACLKPIKDIKGDVRIYPLPHMP
IVKDLVSNLDGAYAQLRSIQPWMQADSAPPPDSERKQSIEERAKLDGMWECILCFCCTTS
CPSYWWNGDKYLGPAVLLAAYRWIADSRDEHTGDRLDGLEDTFKLYACRTIMNCTQTCPK
GLNPAKAIGRIKELQLERKV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggttgaactcagactgccgcgcaacagcacgatcgggaaaggtaaaacctttcccgca
ccagccggtgcaaaaaatgtcagaacattccggatttatcgttggaccccggatgatgac
aaaaacccggttattgatagctacgaacttgatctggataccatcgggccaatggtgctg
gatgccatcatccatatcaagaacgaaatagaccccacactgacattccggcgctcctgc
cgtgaagggatttgtgggtcctgcgccatgaacattgatggggaaaacacgcttgcgtgc
ctgaaacccatcaaggacatcaaaggcgatgtgcgcatctatccgctgccgcatatgcca
attgtaaaagatctggtgtccaatctggatggtgcttatgcgcagttgcgctccatccag
ccttggatgcaggcagacagcgctcctccgccagattccgaacggaagcagagcattgag
gaacgtgccaagctggacgggatgtgggaatgcattctgtgcttctgctgcacgacatcc
tgcccatcctattggtggaatggggacaagtatctaggcccagccgttcttctggcagcg
tatcgttggattgctgatagccgcgatgaacatacgggtgaccgtctggatgggctggaa
gataccttcaaactgtatgcgtgccgtaccatcatgaactgcacccagacatgcccgaag
ggtctgaacccggccaaggccattgggcgtatcaaggaactgcaactggaacggaaagtc
tga

DBGET integrated database retrieval system